KEGG   Mus pahari (shrew mouse): 110325947
Entry
110325947         CDS       T05929                                 
Name
(RefSeq) mannose-binding protein A
  KO
K03991  mannose-binding lectin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04145  Phagosome
mpah04610  Complement and coagulation cascades
mpah05150  Staphylococcus aureus infection
mpah05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110325947
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110325947
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110325947
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110325947
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110325947
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mpah04091]
    110325947
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Phagocytosis
   Opsonins
    110325947
Lectins [BR:mpah04091]
 C-Type lectins
  Group 3: Collectins
   110325947
SSDB
Motif
Pfam: Lectin_C Collagen
Other DBs
NCBI-GeneID: 110325947
NCBI-ProteinID: XP_021059768
Ensembl: MGP_PahariEiJ_G0030160
LinkDB
Position
8:32075978..32082766
AA seq 239 aa
MLLLPLLPVLLCVVSVSSSGSQTCEDTLKTCSVIACGRDGRDGPKGEKGEPGQGLRGLQG
PPGKLGPPGNVGIPGSPGPKGQKGDHGDNRATEAKLANMEAEIRILKSKLELTNKLHAFS
MGKKSGKKLFVTNHEKMPFSKVKSLCTELQGTVAIPRNAEENKAIQEVATGIAFLGITDE
VTEGQFMYVTGGRLTYSNWKKDEPNNHGSGEDCVIILDNGLWNDISCQASFKAVCEFPA
NT seq 720 nt   +upstreamnt  +downstreamnt
atgctcctgcttccattactccctgtccttctgtgtgtggtgagcgtgtcctcatcaggg
tcacaaacctgtgaggacaccctgaagacttgctctgtgatagcctgtggcagagatggg
agagatggacccaaaggggagaagggagaaccaggtcaaggactcaggggtttgcagggc
cctccagggaaattagggcctccaggaaatgttggaatccctggaagtccaggaccaaaa
ggccaaaaaggggatcatggagacaatagagccactgaggcgaagctggcaaatatggag
gcagagataaggatcctgaaatcaaaactggagctaaccaacaagttgcatgccttctca
atgggcaaaaagtctgggaagaagttgtttgtgaccaaccatgaaaagatgcccttttcc
aaagtgaagtctctgtgcacagagctccaaggcactgtggctatccccaggaatgccgaa
gagaacaaggccattcaagaagtggccacaggcattgccttcctaggcatcacggacgag
gtgactgaaggccaattcatgtatgtgacaggggggaggctcacctatagcaactggaaa
aaggatgagcctaataaccatggctctggggaagactgtgtcattatattagataatggt
ttgtggaatgacatttcctgtcaagcttccttcaaggctgtctgtgagttcccagcctga

KEGG   Mus pahari (shrew mouse): 110339172
Entry
110339172         CDS       T05929                                 
Symbol
Mbl2
Name
(RefSeq) mannose-binding protein C
  KO
K03991  mannose-binding lectin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04145  Phagosome
mpah04610  Complement and coagulation cascades
mpah05150  Staphylococcus aureus infection
mpah05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110339172 (Mbl2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110339172 (Mbl2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110339172 (Mbl2)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110339172 (Mbl2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110339172 (Mbl2)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mpah04091]
    110339172 (Mbl2)
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Phagocytosis
   Opsonins
    110339172 (Mbl2)
Lectins [BR:mpah04091]
 C-Type lectins
  Group 3: Collectins
   110339172 (Mbl2)
SSDB
Motif
Pfam: Lectin_C Collagen
Other DBs
NCBI-GeneID: 110339172
NCBI-ProteinID: XP_021078371
Ensembl: MGP_PahariEiJ_G0014362
LinkDB
Position
1:141821411..141828647
AA seq 244 aa
MSLFTSFLLLCVVTAVYAETLTEDVQNTCPVITCSSPGLNGFPGKDGRDGAKGEKGEPGQ
GLRGLQGPPGKVGPAGPPGNPGSKGAVGPKGDRGDSAEFDTGKIDSEIAALRSELRALRK
WVLFSLSEKVGKKYFVSSAKKMSHDRVKALCSEFQGTVATPRNAEENMAIQNVAKDIAYL
GITDERVEGRFEDLTRNRVHYTNWNDGEPNNAGSGEDCVVILGNGKWNDVPCSDSFLAVC
EFSD
NT seq 735 nt   +upstreamnt  +downstreamnt
atgtcccttttcacatccttccttctgctgtgtgtggtaacagcagtttatgcagagacc
ttaactgaagacgttcagaatacctgccctgtgattacctgcagttctccaggcctgaat
ggcttcccaggcaaagatggacgtgacggtgccaagggagaaaagggagaaccaggtcaa
gggctcaggggcttgcagggtcctcctggaaaagtaggacccgcaggacccccggggaat
cctgggtcaaaaggagcagtgggaccgaaaggagaccgtggggacagtgcagaatttgat
actggcaaaattgattcagaaatcgcagccctacgatcagagctgagagccctgagaaag
tgggtgctcttctctctgagtgaaaaagttggaaagaagtattttgtgagcagtgctaaa
aagatgagtcatgatagagtgaaggccctgtgctctgaattccagggcactgtggccact
cccaggaatgctgaggaaaacatggccatccagaatgtggccaaagatattgcctacttg
ggcataacagatgagagggttgaaggccgttttgaggatctgacaagaaacagagtgcac
tacacgaattggaatgatggggagcccaacaacgcaggctctggggaagactgtgtggtg
atcttgggaaatggcaagtggaacgatgtcccctgctcggattcatttttggcagtctgt
gaattctctgactga

DBGET integrated database retrieval system