KEGG   Mus pahari (shrew mouse): 110326057
Entry
110326057         CDS       T05929                                 

Gene name
Csnk1g2
Definition
(RefSeq) casein kinase I isoform X1
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110326057 (Csnk1g2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110326057 (Csnk1g2)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110326057 (Csnk1g2)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   110326057 (Csnk1g2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr CK1gamma_C Pkinase_fungal
Other DBs
NCBI-GeneID: 110326057
NCBI-ProteinID: XP_021059900
Ensembl: MGP_PahariEiJ_G0031007
LinkDB
Position
9
AA seq 442 aa
MDFDKKGGKGELEEGRRMSKTGTSRSNHGVRSSGTSSGVLMVGPNFRVGKKIGCGNFGEL
RLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLSTAGEADSGAGPALLGQQRLRTPS
MDVSFAEGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLITRM
EYVHTKSLIYRDVKPENFLVGRPGSKRQHSIHIIDFGLAKEYIDPETKKHIPYREHKSLT
GTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRA
TPIEVLCESFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRSGYVFDYEYDWAGKP
LPTPIGTVHPDVPSQPPHRDKAQLHTKNQALNSTNGELNTDDPTAGHSNAPIAAPAEVEV
ADETKCCCFFKRRKRKSLQRHK
NT seq 1329 nt   +upstreamnt  +downstreamnt
atggattttgacaagaaaggagggaagggggagttggaggagggcaggagaatgtccaaa
accggcacgagtcggagcaaccacggagtccgcagttcggggaccagctcaggggtcctg
atggtgggcccaaacttccgagtcggcaagaagataggctgcggaaactttggagagctt
cgcctaggaaagaatctgtatacaaatgagtacgtggctatcaagttggagcccatcaag
tcccgggccccacagctgcacctggagtaccgcttctacaagcagctcagcacagcaggt
gaggcggactcgggtgctgggccagcactcctaggccagcagcggctccggacacccagc
atggatgtttccttcgcagagggcgtccctcaggtctactactttggcccctgtgggaag
tacaacgccatggtgctggagctgctggggcccagcctggaggaccttttcgacctatgc
gaccgcaccttcacgctgaagacggtgctgatgatcgccatccagctgatcacgcgcatg
gagtacgtgcacaccaagagcctcatctaccgtgacgtgaagcctgagaacttcctggtt
gggcggccaggcagcaagcggcagcactccatccacatcatcgactttgggctggccaag
gagtacatcgaccctgagaccaagaagcacatcccataccgcgagcacaagagcctgaca
ggcacagcgcgctacatgagcatcaacacacacttgggcaaggagcagagccgccgggat
gacctggaggcgctgggacacatgttcatgtacttcctgcgcggcagtctgccctggcag
gggctcaaggcagacacgctgaaggagcgctaccagaagattggagacaccaagcgtgcc
acgccaatcgaggtgctgtgtgagagcttcccggaggagatggccacctatttgcgctat
gtgcggcgcctagacttttttgagaagccagactacgactacctgaggaagctcttcacc
gacctcttcgaccgcagcggctacgtgtttgactacgagtatgactgggccggcaagccc
ctgccgacacccatcggcaccgtccaccctgacgtgccctcccagccaccacatcgcgac
aaagctcagctccacaccaagaaccaggcgctgaactccactaatggagagctgaacaca
gacgaccccaccgcaggccactccaacgcccccatcgcggcccctgcagaagtagaggtg
gcggatgaaacaaagtgctgctgcttcttcaagaggagaaagagaaaatcgctgcagcga
cataagtga

KEGG   Mus pahari (shrew mouse): 110327644
Entry
110327644         CDS       T05929                                 

Gene name
Csnk1g1
Definition
(RefSeq) casein kinase I isoform X1
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110327644 (Csnk1g1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110327644 (Csnk1g1)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110327644 (Csnk1g1)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   110327644 (Csnk1g1)
SSDB
Motif
Pfam: CK1gamma_C Pkinase PK_Tyr_Ser-Thr Pkinase_fungal
Other DBs
NCBI-GeneID: 110327644
NCBI-ProteinID: XP_021062410
Ensembl: MGP_PahariEiJ_G0015237
LinkDB
Position
10
AA seq 466 aa
MDHSNREKDDRQRATKTMAQRNTHCSRPSGTSTSSGVLMVGPNFRVGKKIGCGNFGELRL
GKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSAGEGLPQVYYFGPCGKYNAMVLEL
LGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQGNKKE
HVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHM
FMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEALCENFPEEMATYLRYVRRLDFFE
KPDYEYLRTLFTDLFERKGYTFDYAYDWVGRPIPTPVGSVHVDSGASAITRESHTHRDRP
SQQPLRNQTTSSERRGEWEIQPSRQTNTSYLTSHLAADRHGGSVQVVSSTNGELNVDDPT
GAHSNAPITAHAEVEVVEEANCLKMLNLWCCCFFKRKRKKTAQRHK
NT seq 1401 nt   +upstreamnt  +downstreamnt
atggaccattctaatagggaaaaggatgatagacaacgggcaactaaaaccatggcacaa
aggaatacacactgttcccgaccttctggcacttcaacatcctctggtgttctcatggtg
ggacccaacttcagggttggcaagaagatagggtgtgggaacttcggagagctcagatta
ggtaaaaatctctacaccaatgaatatgtagccattaaactggaaccaataaaatcacgt
gctccacaacttcatttagagtacaggttttataaacagcttggcagtgcaggtgaaggc
ctcccacaggtttattactttggaccatgtgggaagtacaatgccatggtgctggaactc
cttggccctagcttagaagacttgtttgacctctgtgaccgaacgtttactttgaagacg
gtgttaatgatagccatccagttgctttctcgaatggagtatgtacactcaaagaatctt
atttaccgagatgtcaaaccagagaacttcttgattggccgacaaggcaataagaaagag
catgtaatacacattatagattttggactggccaaggaatacattgatcctgaaaccaaa
aaacacataccttacagagagcacaaaagtttaactggaactgcgcgatatatgtctatc
aacacacatctaggcaaagagcaaagccggcgagatgatttggaagccttaggccatatg
ttcatgtacttcctccgaggcagcctaccctggcaaggactcaaggctgatacgttaaaa
gagagatatcaaaaaattggtgataccaaaaggaatactcccatcgaagctctctgtgag
aactttccagaggagatggcaacctatcttcgatatgtcaggcgattagacttctttgaa
aaacctgattatgaatatttacggaccctcttcacagatctgtttgaacggaaaggctat
acctttgactatgcctatgattgggttggaaggcctattcctactccagtaggatcagtt
catgtagattctggtgcatcggcaataactcgagaaagccacacacacagggatcggcca
tcacaacagcctcttagaaatcagactacatcatcagagcgccgaggagagtgggaaatc
cagcccagccggcagaccaatacctcatacctgacgtctcacttggctgcagaccgccat
gggggttcagtacaggtggttagctcaaccaatggagagctgaatgttgatgaccccact
ggagctcactccaatgcaccgatcacagctcatgccgaagtggaggtagtggaggaagct
aactgcctgaaaatgctcaacctgtggtgctgctgtttctttaagaggaaaaggaagaag
actgctcaaagacacaagtga

KEGG   Mus pahari (shrew mouse): 110332251
Entry
110332251         CDS       T05929                                 

Gene name
Csnk1d
Definition
(RefSeq) casein kinase I isoform X1
  KO
K08959  casein kinase 1, delta [EC:2.7.11.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
mpah04390  Hippo signaling pathway
mpah04540  Gap junction
mpah04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110332251 (Csnk1d)
   04390 Hippo signaling pathway
    110332251 (Csnk1d)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110332251 (Csnk1d)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    110332251 (Csnk1d)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110332251 (Csnk1d)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mpah03036]
    110332251 (Csnk1d)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110332251 (Csnk1d)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   110332251 (Csnk1d)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    110332251 (Csnk1d)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin
Other DBs
NCBI-GeneID: 110332251
NCBI-ProteinID: XP_021069028
Ensembl: MGP_PahariEiJ_G0018677
LinkDB
Position
14
AA seq 428 aa
MELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ
GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRA
ADDAERERRDREERLRHSRNPATRGLPSTASGRLRGTQEVAPPTPLTPTSHTANTSPRPV
SGMERERKVSMRLHRGAPVNVSSSDLTGRQDTSRMSTSQRSRDMASLRLHAARQGARCRP
QRPRRTTY
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggagctgagggtcgggaacaggtaccgactgggccgcaagatcggcagcggctccttc
ggagacatctatctcggtacggacattgctgcgggagaagaagttgccatcaagcttgaa
tgtgtcaaaaccaaacatcctcagctccacattgagagcaagatctacaaaatgatgcag
ggaggagtgggcatccctaccatcagatggtgtggggccgagggggactacaatgtcatg
gtgatggagctactaggacccagcctggaagacctgttcaacttctgttcaaggaagttt
agtctcaaaactgttctgttgcttgctgaccaaatgataagtcgtattgagtacattcat
tcgaagaattttatccaccgagatgtgaagccagataacttcctcatggggctgggaaag
aaaggcaacctggtctacatcattgactttgggctggccaagaagtatcgggatgcacgc
acccaccagcatatcccctatcgagagaacaagaacctcacagggacggcacgctatgcc
tccatcaacacacaccttggcattgaacaatctcgaagggatgacttggagtctctgggg
tacgtgctgatgtacttcaacctgggctctctcccctggcaggggctgaaggccgccacc
aagaggcagaagtatgagaggatcagtgagaagaagatgtccactcccattgaagtgctg
tgcaagggctatccttctgaatttgccacatacctgaatttctgccgttccttacgtttt
gatgacaaacctgactactcctacctgagacagctcttcagaaatctgttccatcgccaa
ggcttctcctacgactatgtgttcgactggaacatgctcaaatttggtgccagccgggct
gcagatgatgctgaacgggaacgccgggatcgagaagaacgattaagacactcccggaat
ccagccactcgtggcctcccttctacagcttccggccgtctgcggggaacccaggaagtg
gctcccccaacgccccttacccctacctcacacacggccaacacctctccgaggcccgtc
tctggcatggaacgagaacggaaagtgagtatgcggctgcaccgtggggccccagtcaac
gtctcctcatctgatctcacgggccgacaagatacctctcgcatgtccacctcacagagg
agcagggacatggcgtctctccggctgcacgcggcccgccaaggtgcccgctgccgtccc
cagcgcccacgacgtaccacctactga

KEGG   Mus pahari (shrew mouse): 110333022
Entry
110333022         CDS       T05929                                 

Gene name
Csnk1g3
Definition
(RefSeq) casein kinase I isoform X1
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110333022 (Csnk1g3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110333022 (Csnk1g3)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110333022 (Csnk1g3)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   110333022 (Csnk1g3)
SSDB
Motif
Pfam: CK1gamma_C Pkinase PK_Tyr_Ser-Thr Pkinase_fungal
Other DBs
NCBI-GeneID: 110333022
NCBI-ProteinID: XP_021070043
Ensembl: MGP_PahariEiJ_G0019015
LinkDB
Position
15
AA seq 455 aa
MDNKKKDKDKSDDRMARPSGRSGHSTRGPGSSSSGVLMVGPNFRVGKKIGCGNFGELRLG
KNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGSGDGIPQVYYFGPCGKYNAMVLELLG
PSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNKAQQV
IHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFM
YFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEMATYLRYVRRLDFFEKPD
YDYLRKLFTDLFDRKGYMFDYEYDWIGKQLPTPVGAVQQDPALSSNREAHQHRDKIQQSK
NQSADHRAAWDSQQANPHHLRAHLAADRHGGSVQVVSSTNGELNTDDPTAGRSNAPITAP
TEVEVMDETNCQKVLNMWCCCFFKRRKRKTIQRHK
NT seq 1368 nt   +upstreamnt  +downstreamnt
atggataataaaaagaaagacaaggacaaatcagatgatagaatggcacggcccagtggt
cggtcagggcacagcactcgaggacctgggtcttcttcatctggagttttaatggttgga
cctaactttagagttgggaaaaaaatcggatgtggcaattttggagaattacgattaggg
aaaaatttatacacaaatgaatatgtggcgattaaactggagcccatgaaatccagagca
ccacagctgcatttggaatacagattctataagcagttaggatctggagatggtatacct
caagtttactattttggcccttgtggtaaatataacgctatggtgctggaactactggga
ccgagtttggaggacttgtttgatctctgtgatagaacattttctcttaaaacagttctc
atgatagctatacagctgatttctcgtatggagtatgtccactcaaagaacttgatatac
agagatgtgaagcctgagaacttcttaataggacggccgggaaacaaagcccagcaagtc
attcatatcatagattttggtttggcaaaggaatatattgatccagagacaaagaaacat
ataccatacagagaacacaaaagccttactggaaccgccagatacatgagcataaacaca
catctaggaaaagaacagagtagaagagatgacttagaagctctgggccatatgttcatg
tacttcctgagaggcagtcttccttggcaaggcttaaaggctgacacattaaaagagagg
tatcagaaaattggagacacaaaacgagccacaccgatagaagtgttgtgtgaaaacttt
ccagaaatggcaacgtatcttcgttatgtacgaaggctagatttttttgaaaagccagac
tacgattacctaagaaagctttttactgacttgtttgatcgcaaagggtatatgtttgat
tatgaatatgactggattggtaaacagttgcctactccagtaggtgcagttcagcaagac
cctgctctgtcatcaaacagagaagcacaccaacacagagataagatacagcagtctaaa
aaccagtcggcagaccacagggcagcttgggactcccagcaggcaaatccccatcatttg
agagctcaccttgcagcagacagacatggtggctcggtacaggttgtgagttctacaaac
ggagagctaaacacggatgaccccacggcaggacggtcgaacgcacccattacagcccct
acagaagtggaggtgatggatgaaacaaactgccagaaagtattgaatatgtggtgctgc
tgtttcttcaaacgaaggaaaaggaaaaccatacagcgtcacaaatga

KEGG   Mus pahari (shrew mouse): 110333354
Entry
110333354         CDS       T05929                                 

Gene name
Csnk1a1
Definition
(RefSeq) casein kinase I isoform X1
  KO
K08957  casein kinase 1, alpha [EC:2.7.11.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04310  Wnt signaling pathway
mpah04340  Hedgehog signaling pathway
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05165  Human papillomavirus infection
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110333354 (Csnk1a1)
   04340 Hedgehog signaling pathway
    110333354 (Csnk1a1)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110333354 (Csnk1a1)
   05226 Gastric cancer
    110333354 (Csnk1a1)
   05224 Breast cancer
    110333354 (Csnk1a1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110333354 (Csnk1a1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110333354 (Csnk1a1)
   05022 Pathways of neurodegeneration - multiple diseases
    110333354 (Csnk1a1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110333354 (Csnk1a1)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110333354 (Csnk1a1)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   110333354 (Csnk1a1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal ABC1 Pox_ser-thr_kin
Other DBs
NCBI-GeneID: 110333354
NCBI-ProteinID: XP_021070608
Ensembl: MGP_PahariEiJ_G0019055
LinkDB
Position
15
AA seq 365 aa
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKCLESPVGKRKRSMTVSPSQDPSFSGLNQ
LFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLM
YFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAP
DYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKS
NMKGF
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggcgagcagcagcggctccaaggccgaatttatcgtcggtgggaaatacaaactggtg
cggaagatcggatctggctctttcggggacatttatctagcgatcaacatcaccaatggc
gaggaagtggcagtgaaactagaatcccagaaggccaggcatccccagttgctgtacgag
agcaaactgtataagattcttcaaggtggggttggcatccctcacatacggtggtatggt
caagaaaaagactataatgtgctagtcatggatctcctgggacccagccttgaagacctc
ttcaatttctgttcaagaaggttcactatgaagactgtacttatgttagctgaccagatg
atcagtagaattgaatatgtgcatacaaagaattttatacacagagacattaaaccagat
aacttcctaatgggtattgggcgtcactgtaataagtgtttagaatctccagtggggaag
aggaaaagaagcatgactgttagtccttctcaggacccatctttctcaggattaaaccag
ttattccttattgattttggtttggccaaaaagtacagagacaacaggacaaggcaacac
ataccatacagagaagataaaaacctcactggcactgcccgatatgccagcattaatgca
catcttggtattgagcagagtcgccgagatgacatggaatctttaggatatgttttgatg
tattttaatagaaccagtctgccgtggcaaggactgaaggctgcaacaaagaaacagaaa
tatgaaaagattagtgaaaagaagatgtccactcctgttgaggtgttgtgtaagggattt
cctgcagaatttgccatgtacttaaattactgtcgtgggctgcgctttgaggaagctccg
gattacatgtatctgaggcagctattccgcatccttttcaggaccctgaaccaccaatat
gactacacatttgattggacgatgttaaagcagaaagcagcccagcaggcagcctcttcc
agtgggcagggtcagcaggcccaaacccccacaggcaagcaaactgacaaaaccaagagt
aacatgaaaggtttctaa

KEGG   Mus pahari (shrew mouse): 110334729
Entry
110334729         CDS       T05929                                 

Definition
(RefSeq) casein kinase I
  KO
K08960  casein kinase 1, epsilon [EC:2.7.11.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04068  FoxO signaling pathway
mpah04310  Wnt signaling pathway
mpah04340  Hedgehog signaling pathway
mpah04390  Hippo signaling pathway
mpah04392  Hippo signaling pathway - multiple species
mpah04710  Circadian rhythm
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110334729
   04340 Hedgehog signaling pathway
    110334729
   04390 Hippo signaling pathway
    110334729
   04392 Hippo signaling pathway - multiple species
    110334729
   04068 FoxO signaling pathway
    110334729
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    110334729
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110334729
   05022 Pathways of neurodegeneration - multiple diseases
    110334729
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110334729
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mpah03036]
    110334729
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110334729
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   110334729
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    110334729
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal ABC1 APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 110334729
NCBI-ProteinID: XP_021072250
Ensembl: MGP_PahariEiJ_G0020016
LinkDB
Position
17
AA seq 416 aa
MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFYKMMQ
GGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGAARN
PEDVDRERREHEREERMGQLRGSATRALPPGPPTGATANRLRSAAEPVASTPASRIQQAG
NTSPRAISRADRERKVSMRLHRGAPANVSSSDLTGRQEVSRIAASQTSVPFDHLGK
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggagctgcgtgtgggaaataagtatcgcctgggccgaaagatcggcagtgggtccttc
ggagacatctacctgggtgccaacattgcctctggtgaggaagtagccatcaagctcgaa
tgtgtgaagacgaagcatccccagctccacatcgagagcaagttctacaagatgatgcag
ggcggagtggggatcccatccatcaagtggtgcggggctgagggagactataacgtgatg
gtcatggagctgctggggcccagcctggaggacctcttcaacttctgttcccggaagttc
agcctcaagacggtgctgttgctggccgaccagatgatcagccgcatcgagtacatacac
tccaagaacttcatccaccgggatgtgaagcccgacaacttcctcatgggcctggggaag
aaaggcaacctagtgtacatcattgacttcggcctggccaagaagtaccgcgatgcccgc
acacaccagcacattccctaccgggaaaacaagaacctgactggcactgcccgctatgcc
tccatcaacacccacctgggcatcgagcaaagccgtcgagatgacctagagagcttgggc
tatgtgctcatgtacttcaacctgggctccctgccctggcaaggcctcaaagcagccacc
aagcgtcagaagtacgagcggattagcgagaagaagatgtcaacgccaattgaggtcctc
tgcaaaggctacccctccgagttctcaacatacctcaacttctgccgctccctgcggttc
gatgataagcctgactactcctacctgcgccagctcttccgaaatctctttcaccggcag
ggtttctcctacgactacgtcttcgactggaacatgctcaaattcggtgcagcccggaat
cccgaggacgtagaccgggaaagacgggagcacgaacgggaagagaggatggggcagttg
cgagggtctgcgaccagagccctgccccctggcccacctacaggggctaccgccaaccga
ctccgaagtgcagccgagcctgtagcttccaccccagcctcccgcatccaacaagctggc
aatacttctcccagagcgatctcacgggccgaccgagagaggaaggtgagcatgagactc
cacagaggtgcccctgccaacgtctcctcctcagacctcactgggcggcaagaggtctcc
cggattgcagcctcacagacaagcgtgccatttgaccatcttgggaaatga

DBGET integrated database retrieval system