KEGG   Mus pahari (shrew mouse): 110326321
Entry
110326321         CDS       T05929                                 

Gene name
Map2k2
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2 isoform X1
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01522  Endocrine resistance
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04024  cAMP signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04068  FoxO signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04140  Autophagy - animal
mpah04150  mTOR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04210  Apoptosis
mpah04218  Cellular senescence
mpah04270  Vascular smooth muscle contraction
mpah04370  VEGF signaling pathway
mpah04371  Apelin signaling pathway
mpah04540  Gap junction
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04613  Neutrophil extracellular trap formation
mpah04620  Toll-like receptor signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah04660  T cell receptor signaling pathway
mpah04662  B cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04720  Long-term potentiation
mpah04722  Neurotrophin signaling pathway
mpah04730  Long-term depression
mpah04810  Regulation of actin cytoskeleton
mpah04910  Insulin signaling pathway
mpah04912  GnRH signaling pathway
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04917  Prolactin signaling pathway
mpah04919  Thyroid hormone signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04926  Relaxin signaling pathway
mpah04929  GnRH secretion
mpah04934  Cushing syndrome
mpah04935  Growth hormone synthesis, secretion and action
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05132  Salmonella infection
mpah05135  Yersinia infection
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05207  Chemical carcinogenesis - receptor activation
mpah05210  Colorectal cancer
mpah05211  Renal cell carcinoma
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05216  Thyroid cancer
mpah05218  Melanoma
mpah05219  Bladder cancer
mpah05220  Chronic myeloid leukemia
mpah05221  Acute myeloid leukemia
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05230  Central carbon metabolism in cancer
mpah05231  Choline metabolism in cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110326321 (Map2k2)
   04012 ErbB signaling pathway
    110326321 (Map2k2)
   04014 Ras signaling pathway
    110326321 (Map2k2)
   04015 Rap1 signaling pathway
    110326321 (Map2k2)
   04370 VEGF signaling pathway
    110326321 (Map2k2)
   04371 Apelin signaling pathway
    110326321 (Map2k2)
   04066 HIF-1 signaling pathway
    110326321 (Map2k2)
   04068 FoxO signaling pathway
    110326321 (Map2k2)
   04072 Phospholipase D signaling pathway
    110326321 (Map2k2)
   04071 Sphingolipid signaling pathway
    110326321 (Map2k2)
   04024 cAMP signaling pathway
    110326321 (Map2k2)
   04022 cGMP-PKG signaling pathway
    110326321 (Map2k2)
   04151 PI3K-Akt signaling pathway
    110326321 (Map2k2)
   04150 mTOR signaling pathway
    110326321 (Map2k2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110326321 (Map2k2)
  09143 Cell growth and death
   04210 Apoptosis
    110326321 (Map2k2)
   04218 Cellular senescence
    110326321 (Map2k2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110326321 (Map2k2)
   04550 Signaling pathways regulating pluripotency of stem cells
    110326321 (Map2k2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110326321 (Map2k2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110326321 (Map2k2)
   04620 Toll-like receptor signaling pathway
    110326321 (Map2k2)
   04650 Natural killer cell mediated cytotoxicity
    110326321 (Map2k2)
   04660 T cell receptor signaling pathway
    110326321 (Map2k2)
   04662 B cell receptor signaling pathway
    110326321 (Map2k2)
   04664 Fc epsilon RI signaling pathway
    110326321 (Map2k2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110326321 (Map2k2)
   04929 GnRH secretion
    110326321 (Map2k2)
   04912 GnRH signaling pathway
    110326321 (Map2k2)
   04915 Estrogen signaling pathway
    110326321 (Map2k2)
   04917 Prolactin signaling pathway
    110326321 (Map2k2)
   04921 Oxytocin signaling pathway
    110326321 (Map2k2)
   04926 Relaxin signaling pathway
    110326321 (Map2k2)
   04935 Growth hormone synthesis, secretion and action
    110326321 (Map2k2)
   04919 Thyroid hormone signaling pathway
    110326321 (Map2k2)
   04916 Melanogenesis
    110326321 (Map2k2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110326321 (Map2k2)
  09156 Nervous system
   04720 Long-term potentiation
    110326321 (Map2k2)
   04730 Long-term depression
    110326321 (Map2k2)
   04722 Neurotrophin signaling pathway
    110326321 (Map2k2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110326321 (Map2k2)
   05206 MicroRNAs in cancer
    110326321 (Map2k2)
   05205 Proteoglycans in cancer
    110326321 (Map2k2)
   05207 Chemical carcinogenesis - receptor activation
    110326321 (Map2k2)
   05230 Central carbon metabolism in cancer
    110326321 (Map2k2)
   05231 Choline metabolism in cancer
    110326321 (Map2k2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110326321 (Map2k2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110326321 (Map2k2)
   05225 Hepatocellular carcinoma
    110326321 (Map2k2)
   05226 Gastric cancer
    110326321 (Map2k2)
   05214 Glioma
    110326321 (Map2k2)
   05216 Thyroid cancer
    110326321 (Map2k2)
   05221 Acute myeloid leukemia
    110326321 (Map2k2)
   05220 Chronic myeloid leukemia
    110326321 (Map2k2)
   05218 Melanoma
    110326321 (Map2k2)
   05211 Renal cell carcinoma
    110326321 (Map2k2)
   05219 Bladder cancer
    110326321 (Map2k2)
   05215 Prostate cancer
    110326321 (Map2k2)
   05213 Endometrial cancer
    110326321 (Map2k2)
   05224 Breast cancer
    110326321 (Map2k2)
   05223 Non-small cell lung cancer
    110326321 (Map2k2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110326321 (Map2k2)
   05170 Human immunodeficiency virus 1 infection
    110326321 (Map2k2)
   05161 Hepatitis B
    110326321 (Map2k2)
   05160 Hepatitis C
    110326321 (Map2k2)
   05164 Influenza A
    110326321 (Map2k2)
   05163 Human cytomegalovirus infection
    110326321 (Map2k2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110326321 (Map2k2)
   05165 Human papillomavirus infection
    110326321 (Map2k2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110326321 (Map2k2)
   05135 Yersinia infection
    110326321 (Map2k2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110326321 (Map2k2)
   05022 Pathways of neurodegeneration - multiple diseases
    110326321 (Map2k2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110326321 (Map2k2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110326321 (Map2k2)
   01522 Endocrine resistance
    110326321 (Map2k2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110326321 (Map2k2)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     110326321 (Map2k2)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: STE group
  STE7 family
   110326321 (Map2k2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Pkinase_fungal Kinase-like Haspin_kinase APH Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 110326321
NCBI-ProteinID: XP_021060315
Ensembl: MGP_PahariEiJ_G0031032
LinkDB
Position
9
AA seq 401 aa
MLARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEELDLDEQQRKRLEAFLTQ
KAKVGELKDDDFERISELGAGNGGVVTKARHRPSGLIMARKLIHLEIKPAVRNQIIRELQ
VLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEDILGKVSIAVLRG
LAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQ
GTHYSVQSDIWSMGLSLVELAIGRYPIPPPDAKELEASFGRPVVDGADGEPHSVSPRPRP
PGRPISVGHGMDSRPAMAIFELLDYIVNEPPPKLPSGVFSSDFQEFVNKCLIKNPAERAD
LKLLMNHAFIKRSEGEEVDFAGWLCRTLRLKQPSTPTRTAV
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgctggcccggaggaagccggtgttaccggcgctcaccatcaaccctaccatcgccgag
ggcccgtcccccaccagcgagggcgcctccgaggcaaacctggtggacctccagaagaag
ctggaagagctagacctggatgagcagcagaggaagcggctggaggccttccttacccag
aaggctaaggtcggtgagctcaaggacgacgactttgagaggatctcagagctgggtgcc
ggcaatggcggagtggtcaccaaggcccggcataggccgtcaggcctcatcatggccaga
aagctgatccacctggagatcaaaccggccgtgcgcaaccagatcatccgggagctgcag
gtgctgcacgagtgcaactcgccctacatcgtgggcttctacggggccttctacagcgac
ggcgagatcagcatctgcatggagcacatggatggtggctcactggaccaggtactgaag
gaggccaagcggatccctgaagacatcttggggaaggtcagcattgcggtgctccggggc
ctggcatacctccgagagaaacaccagatcatgcatagagatgtgaagccctccaacatc
ctggtgaactctcgaggggagattaagctctgcgacttcggggtgagcggccagctgatc
gactccatggccaactcatttgtagggacgcgctcctacatgtccccagagcggctgcag
ggcacccactactctgtgcagtcggacatctggagcatggggctgtcactggtggagctg
gccatcgggaggtaccccattcccccacctgatgccaaggaactagaggccagctttggc
cggccagtggtggacggggcagacggagaaccccatagtgtctccccgaggcccaggccc
cctggacgccccatcagtgtaggtcatgggatggacagccgaccggccatggccatcttt
gagctgctggactacatagtgaatgagccacctcccaagctgcccagtggtgtgttcagc
tcagacttccaggagtttgtgaataaatgtctcattaagaacccagcagagcgcgcagat
ctgaagctgctgatgaaccacgccttcatcaagcgctctgagggggaggaagtggacttc
gctggctggctgtgcagaaccctgcggctgaagcagcccagcacgcccacgcggactgca
gtgtga

KEGG   Mus pahari (shrew mouse): 110327244
Entry
110327244         CDS       T05929                                 

Gene name
Map2k1
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01522  Endocrine resistance
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04024  cAMP signaling pathway
mpah04062  Chemokine signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04068  FoxO signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04114  Oocyte meiosis
mpah04140  Autophagy - animal
mpah04150  mTOR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04210  Apoptosis
mpah04218  Cellular senescence
mpah04270  Vascular smooth muscle contraction
mpah04370  VEGF signaling pathway
mpah04371  Apelin signaling pathway
mpah04380  Osteoclast differentiation
mpah04510  Focal adhesion
mpah04540  Gap junction
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04613  Neutrophil extracellular trap formation
mpah04620  Toll-like receptor signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah04660  T cell receptor signaling pathway
mpah04662  B cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04666  Fc gamma R-mediated phagocytosis
mpah04668  TNF signaling pathway
mpah04720  Long-term potentiation
mpah04722  Neurotrophin signaling pathway
mpah04725  Cholinergic synapse
mpah04726  Serotonergic synapse
mpah04730  Long-term depression
mpah04810  Regulation of actin cytoskeleton
mpah04910  Insulin signaling pathway
mpah04912  GnRH signaling pathway
mpah04914  Progesterone-mediated oocyte maturation
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04917  Prolactin signaling pathway
mpah04919  Thyroid hormone signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04926  Relaxin signaling pathway
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04929  GnRH secretion
mpah04934  Cushing syndrome
mpah04935  Growth hormone synthesis, secretion and action
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05034  Alcoholism
mpah05132  Salmonella infection
mpah05135  Yersinia infection
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05207  Chemical carcinogenesis - receptor activation
mpah05210  Colorectal cancer
mpah05211  Renal cell carcinoma
mpah05212  Pancreatic cancer
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05216  Thyroid cancer
mpah05218  Melanoma
mpah05219  Bladder cancer
mpah05220  Chronic myeloid leukemia
mpah05221  Acute myeloid leukemia
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05230  Central carbon metabolism in cancer
mpah05231  Choline metabolism in cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110327244 (Map2k1)
   04012 ErbB signaling pathway
    110327244 (Map2k1)
   04014 Ras signaling pathway
    110327244 (Map2k1)
   04015 Rap1 signaling pathway
    110327244 (Map2k1)
   04370 VEGF signaling pathway
    110327244 (Map2k1)
   04371 Apelin signaling pathway
    110327244 (Map2k1)
   04668 TNF signaling pathway
    110327244 (Map2k1)
   04066 HIF-1 signaling pathway
    110327244 (Map2k1)
   04068 FoxO signaling pathway
    110327244 (Map2k1)
   04072 Phospholipase D signaling pathway
    110327244 (Map2k1)
   04071 Sphingolipid signaling pathway
    110327244 (Map2k1)
   04024 cAMP signaling pathway
    110327244 (Map2k1)
   04022 cGMP-PKG signaling pathway
    110327244 (Map2k1)
   04151 PI3K-Akt signaling pathway
    110327244 (Map2k1)
   04150 mTOR signaling pathway
    110327244 (Map2k1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110327244 (Map2k1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    110327244 (Map2k1)
   04210 Apoptosis
    110327244 (Map2k1)
   04218 Cellular senescence
    110327244 (Map2k1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110327244 (Map2k1)
   04540 Gap junction
    110327244 (Map2k1)
   04550 Signaling pathways regulating pluripotency of stem cells
    110327244 (Map2k1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110327244 (Map2k1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110327244 (Map2k1)
   04620 Toll-like receptor signaling pathway
    110327244 (Map2k1)
   04650 Natural killer cell mediated cytotoxicity
    110327244 (Map2k1)
   04660 T cell receptor signaling pathway
    110327244 (Map2k1)
   04662 B cell receptor signaling pathway
    110327244 (Map2k1)
   04664 Fc epsilon RI signaling pathway
    110327244 (Map2k1)
   04666 Fc gamma R-mediated phagocytosis
    110327244 (Map2k1)
   04062 Chemokine signaling pathway
    110327244 (Map2k1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110327244 (Map2k1)
   04929 GnRH secretion
    110327244 (Map2k1)
   04912 GnRH signaling pathway
    110327244 (Map2k1)
   04915 Estrogen signaling pathway
    110327244 (Map2k1)
   04914 Progesterone-mediated oocyte maturation
    110327244 (Map2k1)
   04917 Prolactin signaling pathway
    110327244 (Map2k1)
   04921 Oxytocin signaling pathway
    110327244 (Map2k1)
   04926 Relaxin signaling pathway
    110327244 (Map2k1)
   04935 Growth hormone synthesis, secretion and action
    110327244 (Map2k1)
   04919 Thyroid hormone signaling pathway
    110327244 (Map2k1)
   04928 Parathyroid hormone synthesis, secretion and action
    110327244 (Map2k1)
   04916 Melanogenesis
    110327244 (Map2k1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110327244 (Map2k1)
  09156 Nervous system
   04725 Cholinergic synapse
    110327244 (Map2k1)
   04726 Serotonergic synapse
    110327244 (Map2k1)
   04720 Long-term potentiation
    110327244 (Map2k1)
   04730 Long-term depression
    110327244 (Map2k1)
   04722 Neurotrophin signaling pathway
    110327244 (Map2k1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110327244 (Map2k1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110327244 (Map2k1)
   05206 MicroRNAs in cancer
    110327244 (Map2k1)
   05205 Proteoglycans in cancer
    110327244 (Map2k1)
   05207 Chemical carcinogenesis - receptor activation
    110327244 (Map2k1)
   05230 Central carbon metabolism in cancer
    110327244 (Map2k1)
   05231 Choline metabolism in cancer
    110327244 (Map2k1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110327244 (Map2k1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110327244 (Map2k1)
   05212 Pancreatic cancer
    110327244 (Map2k1)
   05225 Hepatocellular carcinoma
    110327244 (Map2k1)
   05226 Gastric cancer
    110327244 (Map2k1)
   05214 Glioma
    110327244 (Map2k1)
   05216 Thyroid cancer
    110327244 (Map2k1)
   05221 Acute myeloid leukemia
    110327244 (Map2k1)
   05220 Chronic myeloid leukemia
    110327244 (Map2k1)
   05218 Melanoma
    110327244 (Map2k1)
   05211 Renal cell carcinoma
    110327244 (Map2k1)
   05219 Bladder cancer
    110327244 (Map2k1)
   05215 Prostate cancer
    110327244 (Map2k1)
   05213 Endometrial cancer
    110327244 (Map2k1)
   05224 Breast cancer
    110327244 (Map2k1)
   05223 Non-small cell lung cancer
    110327244 (Map2k1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110327244 (Map2k1)
   05170 Human immunodeficiency virus 1 infection
    110327244 (Map2k1)
   05161 Hepatitis B
    110327244 (Map2k1)
   05160 Hepatitis C
    110327244 (Map2k1)
   05164 Influenza A
    110327244 (Map2k1)
   05163 Human cytomegalovirus infection
    110327244 (Map2k1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110327244 (Map2k1)
   05165 Human papillomavirus infection
    110327244 (Map2k1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110327244 (Map2k1)
   05135 Yersinia infection
    110327244 (Map2k1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110327244 (Map2k1)
   05022 Pathways of neurodegeneration - multiple diseases
    110327244 (Map2k1)
  09165 Substance dependence
   05034 Alcoholism
    110327244 (Map2k1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110327244 (Map2k1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110327244 (Map2k1)
   01522 Endocrine resistance
    110327244 (Map2k1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110327244 (Map2k1)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     110327244 (Map2k1)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: STE group
  STE7 family
   110327244 (Map2k1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Pkinase_fungal Kinase-like Seadorna_VP7 Haspin_kinase NAD_binding_6
Other DBs
NCBI-GeneID: 110327244
NCBI-ProteinID: XP_021061709
Ensembl: MGP_PahariEiJ_G0015207
LinkDB
Position
10
AA seq 393 aa
MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYL
REKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELLFGCHVEGDAAETPPRPRTPGRPLSSY
GMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAF
IKRSDAEEVDFAGWLCSTIGLNQPSTPTHAASI
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgcccaagaagaagccgacgcccatccagctgaacccggcccccgatggctcggcggtt
aacgggaccagctcggccgaaaccaacctagaggccttgcagaagaagctggaggagctg
gagcttgatgagcagcagcggaagcgccttgaggcctttctgacgcagaagcagaaggtg
ggagaactgaaggatgatgactttgagaagatcagcgaactgggagctggcaatggtgga
gtggtcttcaaggtctcccacaagccatctggcctggttatggctagaaagctgatccac
ctggagatcaaacctgcaatccggaaccagatcatccgggagctgcaggtgctgcatgag
tgcaactcgccctacatcgtgggcttctacggggccttctacagcgacggtgagatcagc
atctgcatggagcacatggatggtgggtccttggatcaagttctgaagaaagctggaaga
attcctgagcaaattttaggaaaagttagcattgctgtgataaaaggcctgacctatctt
cgggagaagcacaagattatgcacagagatgtcaagccatccaacattctagtgaactca
cgtggggagatcaaactctgtgattttggggtcagtgggcagctaattgactccatggcc
aactccttcgtgggcacaaggtcctacatgtcgcctgagagactccagggaactcactac
tctgtgcagtcagacatctggagcatggggctctctctggtggagatggcagttgggaga
taccccattcctcctcctgatgccaaggagctggagctactgtttggatgccatgtggaa
ggagacgcagctgaaacaccacccaggccaaggacccctgggaggcctctcagctcatat
ggaatggacagccgacctcccatggcaatttttgagttgttggattacattgtaaatgag
cctcctccaaaactgcccagtggagtcttcagtctggagtttcaggattttgtgaataaa
tgcttaataaagaaccctgcagagagagcagatctgaagcagctaatggtacatgctttc
atcaaaagatctgatgccgaggaggtagacttcgcaggctggctctgctccaccattggg
cttaaccagcccagcacaccaactcacgctgccagcatatga

DBGET integrated database retrieval system