KEGG   Mus pahari (shrew mouse): 110327093
Entry
110327093         CDS       T05929                                 
Symbol
Icoslg
Name
(RefSeq) ICOS ligand
  KO
K06710  inducible T-cell co-stimulator ligand
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110327093 (Icoslg)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    110327093 (Icoslg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110327093 (Icoslg)
CD molecules [BR:mpah04090]
 Proteins
  110327093 (Icoslg)
SSDB
Motif
Pfam: C2-set_2 V-set Ig_3 ig Tmemb_cc2
Other DBs
NCBI-GeneID: 110327093
NCBI-ProteinID: XP_021061475
Ensembl: MGP_PahariEiJ_G0030916
LinkDB
Position
9:42742455..42752850
AA seq 349 aa
MQLKCPCFASLGTRQPVWKKLHLSSGFLSGLGLFLVLFSSLRAETEVKEIHAMVGSDVEL
GCIDPHKRHFNLSGLYVYWQIENLKAAVTYYLPYKSPGIDVNSSYKNRGHLSLDCMKQGD
FSLYLKNVTPQDTQEFTCRVFMNTATELVKILEEVVRLRVAANFSTPVISTSGSSDPGQE
LTYTCMSKNGYPKPNLYWINTTDNSLIDTALQNNTVYLNEWGLYDVISTLRLPWTSGRDV
LCCVENVALHQNITSISQAESFTGNMNTTNPQETHNKGIKVLLAVLAVLLVAVAVVSFIK
YRHRHPHRSYTGPRTVELELTDEWGPVPYRDYLYPRYLMLPCLKILALP
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgcagctaaagtgtccctgttttgcgtccttggggaccaggcagcctgtttggaagaag
ctccatctttctagcgggttcctttctggtcttggtctgttcttggtgctgtttagcagc
ctccgtgccgagactgaagttaaggaaatccatgcaatggtgggcagcgatgtggagctc
ggatgcattgacccccacaaacgccatttcaacttgagtggtctgtatgtctattggcaa
atcgaaaacctaaaagctgcagtgacttactacctgccttacaagtctccagggatcgat
gtgaacagttcctacaagaacagaggccatctgtccctggactgcatgaagcagggtgac
ttttctctgtacctgaagaatgtcacccctcaggatacccaggagttcacatgccgggta
tttatgaatacagccacagagttagtcaagatcttggaagaggtggtcaggctacgtgtg
gcagcgaacttcagtacacctgtcatcagcacctctggtagttctgaccctggccaggaa
cttacctacacctgcatgtccaagaatggctacccaaagcccaacctgtattggatcaac
acaacggacaatagcctaatagacaccgccctgcagaataacactgtctacttgaacgag
tggggcctgtatgatgtaatcagcacattaaggctaccttggacatctggtagggatgtt
ctctgctgcgtagagaatgtggctctccaccagaacatcaccagcatcagccaggcagaa
agtttcactggaaacatgaacacaacgaacccacaggaaacccacaacaaggggataaaa
gtccttttggctgtccttgctgtactactggtggcagtggctgtagtttcctttatcaag
tacagacacaggcatccccaccgaagctatacaggacccaggactgtagagcttgaactc
acagatgaatggggtccagtcccctatagggactatttgtatccaagatatttgatgctg
ccatgcctcaaaatacttgctttgccataa

DBGET integrated database retrieval system