KEGG   Mus pahari (shrew mouse): 110327227
Entry
110327227         CDS       T05929                                 
Symbol
Ncam1
Name
(RefSeq) neural cell adhesion molecule 1 isoform X1
  KO
K06491  neural cell adhesion molecule
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah05020  Prion disease
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110327227 (Ncam1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    110327227 (Ncam1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110327227 (Ncam1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mpah04515]
    110327227 (Ncam1)
   04090 CD molecules [BR:mpah04090]
    110327227 (Ncam1)
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110327227 (Ncam1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
    110327227 (Ncam1)
Membrane trafficking [BR:mpah04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    110327227 (Ncam1)
Cell adhesion molecules [BR:mpah04515]
 Immunoglobulin superfamily
  NCAM1/2
   110327227 (Ncam1)
CD molecules [BR:mpah04090]
 Proteins
  110327227 (Ncam1)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Adhesion molecules of cell surface
   110327227 (Ncam1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
 Others
  110327227 (Ncam1)
SSDB
Motif
Pfam: I-set Ig_3 ig Ig_2 fn3 V-set C2-set_2 Ig_5 Ig_6 C1-set Ig_C17orf99 Adeno_E3_CR1 Collagen_bind_2
Other DBs
NCBI-GeneID: 110327227
NCBI-ProteinID: XP_021061682
Ensembl: MGP_PahariEiJ_G0015048
LinkDB
Position
10:complement(44636408..44935494)
AA seq 1115 aa
MLRTKDLIWTLFFLGTAVSLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGE
KLSPNQQRISVVWNDDDSSTLTIYNANIDDAGIYKCVVTAEDGTQSEATVNVKIFQKLMF
KNAPTPQEFKEGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIK
KTDEGTYRCEGRILARGEINFKDIQVIVNVPPTVQARQSIVNATANLGQSVTLVCDADGF
PEPTMSWTKDGEPIENEEEDDEKHIFSDDSSELTIRNVDKNDEAEYVCIAENKAGEQDAS
IHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKTLDGHM
VVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEG
NQVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPDSENDFGNYNC
TAVNRIGQESLEFILVQADTPSSPSIDRVEPYSSTAQVQFDEPEATGGVPILKYKAEWKS
LGEESWHFKWYDAKEANMEGIVTIMGLKPETRYSVRLAALNGKGLGEISAATEFKTQPVR
EPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVKYRALASEWKPEIRLPSGSDHVM
LKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIPANGSPTAGLSTGAIVGILIV
IFVLLLVVMDITCYFLNKCGLLMCIAVNLCGKAGPGAKGKDMEEGKAAFSKDESKEPIVE
VRTEEERTPNHDGGKHTEPNETTPLTEPELPADTTATVEDMLPSVTTVTTNSDTITETFA
TAQNSPTSETTTLTSSIAPPATTGPDSNSVPAGQATPSKGVTASSSSPASAPKVAPLVDL
SDTPTSAPSASNLSSTVLANQGAVLSPSSPANAGETSKAPPTSKASPTPTPTPAGAASPL
AAVAAPATEAPQAKQEAPSTKGPDPEPTQPGTVKNPPEAATAPASPKSKAATTNPSQGED
LKMDEGNFKTPDIDLAKDVFAALGSPAPATGASGQASELAPSTADSAVPPAPAKTEKGPV
ETKSEPPESEAKPAPTEVKTVPNDATQTKENESKA
NT seq 3348 nt   +upstreamnt  +downstreamnt
atgctgcgaactaaggatctcatctggactttgtttttcctgggaactgcagtttccctg
caggtagatattgttcccagccaaggagaaatcagcgttggagagtccaaattcttcctg
tgtcaagtggcaggagatgccaaagataaggacatctcctggttctcgcccaatggggag
aagctgagcccaaaccagcagcggatctcagtggtgtggaatgatgacgactcctctacc
ctcaccatctacaacgccaacatcgacgatgccggcatttacaagtgtgtggtcactgct
gaggatggcacccagtccgaggccactgtcaacgtgaagatctttcagaagctcatgttc
aagaatgcaccaaccccacaggagtttaaggaaggagaggatgctgtgattgtctgtgat
gtcgtcagctccctgcccccaaccatcatctggaaacacaaaggccgagatgtcattctg
aaaaaagacgtccggttcatagtcctgtccaacaactacctgcagatccggggcatcaag
aaaacagatgagggcacttaccgctgtgagggcaggatcctggcccgaggggaaatcaac
ttcaaggacattcaggtcattgtgaatgtaccacccactgtccaggccagacagagcatc
gtgaatgccactgccaacctgggccagtctgtcaccctggtgtgtgatgccgatggcttc
ccagagcccaccatgagctggacaaaggatggggaacccatagagaatgaggaggaagat
gacgagaagcacatcttcagtgatgacagctctgagctgaccatcaggaatgtggacaaa
aatgacgaggctgaatacgtctgcatcgcggagaacaaggctggcgagcaggatgcctcc
atccacctcaaggtctttgcaaagcccaaaatcacctatgtagagaatcagacagccatg
gaactagaggagcaagtcactctgacctgtgaagcctccggagaccccatcccctccatc
acctggagaacatccacccggaacatcagcagtgaagaaaagacgctggatgggcacatg
gtggtacgcagccatgcccgtgtgtcctccctgaccctaaagagtatccagtacacagat
gctggcgaatacatctgcactgccagcaacaccatcggccaggactcccagtccatgtac
ctcgaggttcaatatgctcccaagctccagggccccgtggctgtgtacacttgggaaggg
aatcaggtgaacatcacctgtgaggtcttcgcctacccaagtgccaccatctcctggttc
cgagatggtcagttgctgccgagctccaactacagcaatatcaagatctacaacacccca
tccgctagctatctggaggtgacccctgattcagaaaatgactttggaaactacaactgt
acagcagtgaaccgtattggacaggagtccttggaattcatccttgttcaagcagacaca
ccgtcttctccatccatcgaccgggtggaaccatactccagcacggcgcaggtgcagttt
gatgagccagaggccacgggtggagtgcccatcctcaagtacaaggctgagtggaagtca
ctgggcgaagagtcatggcatttcaagtggtatgatgccaaagaagccaacatggaaggc
attgtcaccatcatgggcctgaaacctgagacgaggtactcggtacgactggcggccctc
aacggcaaggggctgggcgagatcagtgcggccactgagttcaagacacagccagtccgg
gaacccagtgcacccaagctggaagggcagatgggagaggacgggaactccatcaaggtg
aacctgatcaagcaggatgacggaggctcccccatcagacactatctggtcaagtacaga
gcgcttgcctctgagtggaaaccggaaatcaggctcccatccggcagtgaccacgtcatg
ctcaagtccctggactggaatgcggagtatgaagtctatgtggtagctgagaaccagcaa
ggaaaatccaaggcagctcattttgtgttcaggacctcagcccagcccacggccatccca
gccaatggcagccccaccgcaggcctgagcacgggcgccattgtgggcatcctcattgtc
atcttcgtcctgctcctggtggtcatggacatcacctgctacttcctgaacaagtgtggc
ctgctcatgtgcatcgctgtgaacctgtgcggcaaagctgggcctggagccaagggcaaa
gatatggaggagggcaaggctgctttctcgaaagatgagtctaaagaacccattgtggag
gtccgaacagaggaagaacggactccaaaccatgatggggggaagcacacggagcccaat
gagaccacgccgctgacagagcccgagctgcctgccgacaccacagccactgtcgaggac
atgctgccttctgtcaccaccgtcaccactaactctgacactatcaccgaaacctttgcc
actgctcagaacagccctaccagtgagaccactacactgacctccagtattgccccaccg
gccacaactgggccagactcaaattctgtgcccgctggtcaggccaccccttccaagggt
gtcactgcttcatcctcgtccccagcctcagccccaaaagttgctcctcttgttgatctg
agtgataccccaacctcagctccctctgctagcaatctgtcctccacggtcttggctaac
caaggagccgtactcagtcctagcagccctgccaatgcgggagagacctccaaagcccct
ccaaccagtaaggcctctcccactcccaccccaactccagctggggcagccagcccctta
gcagcagtagccgcccctgccacagaagccccccaggccaagcaggaagcccccagcacc
aaaggtccggacccagagcccacccagcctggcaccgtgaagaacccaccagaggcagcc
acagcccctgctagcccgaagagcaaggctgcaaccacaaacccttcccagggcgaggac
ttaaaaatggacgaagggaacttcaagaccccagatattgaccttgcaaaggatgttttt
gcagccctgggctctcctgctcctgccactggggccagtggacaagcctctgagcttgct
ccttccactgcagacagcgctgtgcctcccgcaccagcaaagaccgagaaaggccctgta
gaaacaaagtctgagccccctgagtcagaagccaagccagcgccaactgaagtcaagacg
gtccccaacgacgccacacaaacaaaagagaatgagagcaaagcatga

KEGG   Mus pahari (shrew mouse): 110329638
Entry
110329638         CDS       T05929                                 
Symbol
Ncam2
Name
(RefSeq) neural cell adhesion molecule 2 isoform X1
  KO
K06491  neural cell adhesion molecule
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah05020  Prion disease
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110329638 (Ncam2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    110329638 (Ncam2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110329638 (Ncam2)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mpah04515]
    110329638 (Ncam2)
   04090 CD molecules [BR:mpah04090]
    110329638 (Ncam2)
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110329638 (Ncam2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
    110329638 (Ncam2)
Membrane trafficking [BR:mpah04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    110329638 (Ncam2)
Cell adhesion molecules [BR:mpah04515]
 Immunoglobulin superfamily
  NCAM1/2
   110329638 (Ncam2)
CD molecules [BR:mpah04090]
 Proteins
  110329638 (Ncam2)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Adhesion molecules of cell surface
   110329638 (Ncam2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
 Others
  110329638 (Ncam2)
SSDB
Motif
Pfam: I-set Ig_3 ig Ig_2 fn3 V-set C2-set_2 Ig_C17orf99 Ig_6 Ig_5 Ig_4 Izumo-Ig Adeno_E3_CR1 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 110329638
NCBI-ProteinID: XP_021065049
Ensembl: MGP_PahariEiJ_G0016591
LinkDB
Position
12:72871174..73290699
AA seq 837 aa
MSLLLSFYLLGLLVRSGQALLQVTISLSKVELSVGESKFFTCTAIGEPESIDWYNPQGEK
IISTQRVMLQKEGVRSRLTIYNANIEDAGIYRCQATDAKGQTQEATVVLEIYQKLTFREV
VSPQEFKQGEDAEVVCRVSSSPAPAVSWLYHNEEVTTIPDNRFAVLANNNLQILNINKSD
EGIYRCEGRVEARGEIDFRDIIVIVNVPPTIMMSQKSFNATAERGEEMTLTCKASGSPDP
TISWFRNGKLIEENEKYILKGSNTELTVRNIINKDGGSYICKATNKAGEDQKQAFLQVFV
QPHILQLKNETTSENGHVTLVCEAEGDPVPEITWKRAIDGVTFSEGDKSPDGRIEVKGQH
GRSSLHIRDVKLSDSGRYDCEAASRIGGHQRSMHLDIEYAPKFVSNQTMYYSWEGNPINI
SCDVRANPPASIHWRREKLLLPAKNTTHLKTHSVGRKMILEIAPTSDNDFGRYNCTATNR
IGTRFQEYILELADVPSSPHGVKIIELSQTTAKISFNKPDSHGGVPIHHYQVDVKEVASE
TWKIVRSHGVQTMVVLSSLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPPSIH
GQPSSGKSFKISITKQDDGGAPILEYIVKYRSKDKEDQWLEKKVQGNKDHIILEHLQWTM
GYEVQITAANRLGYSEPTVYEFSMPPKPNIIKDTLFNGLGLGAIIGLGVAALLLILVVTD
VSCFFIRQCGLLMCITRRMCGKKSGSSGKSKELEEGKAAYLKDGSKEPIVEMRTEDERIT
NHEDGSPVNEPNETTPLTEPEKLPLKEENGKEVLNAESIEIKVSNDIIQSKEDDIKA
NT seq 2514 nt   +upstreamnt  +downstreamnt
atgagcctcctcctctccttctacctgctcgggttgcttgtcaggagcgggcaagctctt
cttcaagtgacaatttcacttagcaaagtagagcttagcgtgggtgaatctaaattcttc
acatgtacagccattggtgagcctgagagtatagactggtataaccctcaaggagagaag
atcatttcaacgcagagggttatgctacagaaggagggtgtcaggtcgcgactcaccatc
tacaacgcaaacatagaagatgcagggatatatcgctgtcaagcgacagatgccaaagga
cagacacaagaagctacagtagtgttggaaatttaccaaaaactcaccttcagagaagtg
gtatcccctcaagagttcaagcaaggagaggatgcagaagtggtttgcagagtgagcagt
tcccccgcgcctgcggtcagctggttgtaccacaacgaggaagtcaccaccatccccgac
aatcggtttgcagtgcttgcaaacaataatttgcagatcctcaatatcaacaaaagtgat
gaaggtatatacagatgtgaaggaagagtggaggcgaggggagagattgacttccgggat
atcattgtgattgttaacgttccaccaacaatcatgatgtcccagaagtccttcaatgct
acagcagagagaggagaagaaatgaccttgacctgcaaggcctcaggctccccagatccc
accatctcttggttcaggaacggcaaactcattgaagaaaatgaaaagtatattttaaag
ggcagtaatacagagctcactgtcaggaacataatcaataaagacggaggctcttatatc
tgcaaagcaacaaacaaggctggggaagatcaaaagcaggcctttctacaagtgtttgta
cagccgcatatattacaacttaaaaatgagacgacgtctgagaatggtcatgtcacactt
gtctgtgaagcagaaggggatcctgttccagaaatcacatggaaaagagccattgatgga
gtcacattttctgaaggtgataagagcccggacggccgcatcgaagttaaagggcagcat
ggacgctcttcactgcacattagagatgtgaagttgtcagattcggggagatacgactgt
gaggccgcgagtcggattggcgggcaccagaggagcatgcacctggacatagaatatgct
cctaagtttgtttcaaatcagacaatgtattactcttgggaaggaaatccaatcaatata
agttgtgatgtgagagcaaacccacctgcgtcaatccactggagaagagagaaactgctc
ttaccagctaagaatacgactcatttaaaaactcacagtgtagggagaaagatgatactc
gagattgcccccacatcagacaatgactttggacgatataactgcactgctactaaccgt
ataggcacaagatttcaggaatatattcttgaattagcagatgtcccctctagtccccat
ggagtgaagattatagagctgtcacagacgacagccaagatctctttcaataaacccgac
tcccatggaggtgtgcctattcatcactatcaagtggatgtcaaagaagtggcatcggaa
acctggaaaatagtacgctcccatggagttcaaacgatggttgttttgagcagtctggaa
ccaaatacgacttatgaaattagggttgcagcagtgaatggcaaagggcaaggagactac
agtaaaatagaaatattccagacactgccagtccgtgagccaagtcccccttccatacat
ggacagccaagcagtggcaagagttttaaaatcagcatcaccaagcaagatgatggaggg
gctcccattttagaatacattgtgaaatacagaagtaaagacaaggaagaccagtggctg
gagaagaaggtacaggggaacaaagaccacattatcttggagcatctgcagtggacaatg
ggctatgaagtgcaaatcacagctgccaaccgactggggtattccgagcctactgtatat
gagttcagcatgcccccaaagcccaacattattaaagacacactttttaatggccttggc
ctaggcgccatcattggccttggagtcgctgcccttttgctaatccttgtggtaacagac
gtcagctgcttcttcattcgacaatgtgggttactaatgtgcatcaccaggagaatgtgc
gggaaaaagagtggttccagtggaaaaagtaaagaacttgaagaaggaaaagcagcttac
ctgaaagatggatcaaaagaaccaatagtggaaatgagaacagaagatgaaagaatcact
aatcatgaagatgggagtccagtaaatgagccaaatgaaaccacacctctaacagaacct
gaaaaattgcctttaaaagaagaaaatggaaaagaagttttaaatgcagaatctatagaa
attaaagtgtccaatgacatcatccagtctaaagaagatgacataaaggcctaa

DBGET integrated database retrieval system