KEGG   Mus pahari (shrew mouse): 110327271
Entry
110327271         CDS       T05929                                 
Symbol
Itgax
Name
(RefSeq) integrin alpha-X
  KO
K06462  integrin alpha X
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
mpah04810  Regulation of actin cytoskeleton
mpah05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110327271 (Itgax)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110327271 (Itgax)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110327271 (Itgax)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mpah04515]
    110327271 (Itgax)
   04090 CD molecules [BR:mpah04090]
    110327271 (Itgax)
Cell adhesion molecules [BR:mpah04515]
 Integrins
  Integrin alpha subunits
   110327271 (Itgax)
CD molecules [BR:mpah04090]
 Proteins
  110327271 (Itgax)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_3 Integrin_alpha
Other DBs
NCBI-GeneID: 110327271
NCBI-ProteinID: XP_021061748
Ensembl: MGP_PahariEiJ_G0013745
LinkDB
Position
1:97607380..97628859
AA seq 1170 aa
MSCTWIAFLLLMGLVSCLGFNLDAEKPAHFHMDGAEFGHSVLQYDSSWVVVGAPKEIKAT
NQIGGLYKCGYHTGNCEPISLQVPPEAVNMSLGLSLATATNPSRLLACGPTVHHTCRENT
YLTGLCFLLSSSFEQNQSFPPAQQECPRQDQDIVFLIDGSGSISSTDFEKMLDFVKVVMS
QLQRPSTRFSLMQFSHNFWIHFTFNDFISTSRPLSLLASVRQLGGYTYTATAIKHVITEL
FTTQSGSRQDATKVLIVITDGRKQGDNLNYDSVIPMAEAAGIIRYAIGVGKAFYEAQSKQ
ELEAIASSPSHEHIFSVENFDALKDIENQLKEKIFAIEGTETPSSSSFELEMSQEGFSAV
FTPDGPVLGAVGSFSWSGGAFLYPPNMRPTFINMSQENEDMRDAYLGYSTTLAFWKGVHS
LILGAPRHQHTGKAVIFTQESRHWRPKSEVRGTQIGSYFGASLCSVDMDRDGSTDLVLIG
APHYYEHTRGGQVSVCPMPGVRSRWQCGATLHGEQGHLWGRFGAALTVLGDVNGDSLADV
AIGAPGEEENRGAVYIFHGASRQDVAPSPSQRISGSQIPSRLQYFGQSLSGGQDLTRDGL
VDLAVGSKGRVLLLRTRPILRVSPTVHFTPAEISRSVFECQEQVTPEQTLGDATVCLHIY
ESPKTQRGDLQSTVTFDLALDHGRLSPRAIFKETKTWTLTRVKTLGLNKYCESVKLLLPA
CVEDSVTPITLRLNYSLVGVPIRSLQNLQPMLAVDDQTYLTASLPFEKNCGADHICQDDL
SIIFGFPDLKTLVVGSDLELNVGVTVSNDGEDSYGTTVTLFYPVGLSFRRVAEGQVFLRK
KENQQWQRRGQHSLHLMCDSTLDRSQGLWSTSCSSRHVIFRGGSQMTFLVTFDVSPKAEL
GDRLLLRARVRSENSVPGTQKPTFQLELPVKYAVYAVISSHDQFTKYLNFSTSEKEKTSV
IEHRFQVNNLGQRDMPVSINFWVPIELKGEPVWTVMVSHPQNPFTQCYRNRLKPTQFDLL
THMQKSPVLDCSIADCLHLRCDVPSLGILDELDFILKGNLSFGWISQTLQKKVLLLSEAE
ITFNTSVYSQLPGQEAFLRAKTKTVLEMYKVHNPVPLIVGSSVGGLLLLALITAILYKAG
FFKRQYKEMLEEANGQFVSENGTPTPQVAQ
NT seq 3513 nt   +upstreamnt  +downstreamnt
atgagctgtacctggatagcctttctcctgctgatggggcttgtttcttgtcttggcttc
aacttggatgcagagaagccggcacattttcacatggacggcgctgagttcggacacagc
gtactccagtatgatagctcctgggtggtggttggagcaccaaaggaaataaaagccact
aatcaaataggtggcctctacaaatgtggctatcacacaggcaactgtgagcccatctcc
ctccaggtgcccccagaggctgtgaacatgtccctgggcctgtcccttgctactgccacc
aacccttcccggctgttggcttgtggtcctactgtgcaccacacatgcagagagaataca
tacttgacagggctctgctttctactgagttcatcattcgagcagaaccagagcttccca
cctgcacagcaggagtgtccaaggcaagaccaagacattgtgttcctgattgacggctcg
ggtagcatcagttccacagattttgaaaaaatgctggacttcgttaaagtcgtgatgagc
cagcttcagagacctagcacacggttctccctgatgcagttctcccataatttctggatc
cattttactttcaacgacttcatctccacgtcaaggcctttaagtctgttggcttctgta
agacagctaggagggtacacatacacagccacagctatcaagcatgtcataacagagctg
ttcaccacccaaagtggatctcggcaagatgccaccaaggtcctcattgtcatcactgat
gggagaaaacaaggggacaacttgaattatgatagtgtcatccccatggcagaggctgca
ggcatcattcgttatgcaattggggtaggaaaggccttttacgaagcacagtccaagcaa
gaattagaggccatcgcatcgagcccttcccatgaacacatattcagcgtggagaacttt
gacgctttgaaggatattgagaatcagctgaaggagaagatctttgccattgagggtaca
gagacgccaagcagcagttcttttgaattggagatgtcccaggagggcttcagtgctgtg
tttacacctgatggaccagttctgggggctgtgggaagcttcagctggtctggaggtgcc
ttcttgtaccccccaaatatgagacccaccttcatcaacatgtctcaggagaacgaggac
atgagggacgcttacctgggttactccaccacactggccttttggaagggggtccacagc
ctgatcctgggggccccgcgccaccaacacacggggaaggctgtcatctttacccaggaa
tccaggcactggaggcccaagtctgaagtcagagggacgcagatcggctcctactttggg
gcatctctctgttctgtggacatggatagagacggcagcactgacctggtcctgatcgga
gccccccattactatgagcacacccgaggggggcaggtgtcggtgtgccccatgcccggt
gtgaggagcaggtggcagtgtggggccaccctccatggggagcagggccatctttggggc
cgctttggggcggctctgacagtgctaggggacgtgaacggggacagtctggcggatgtg
gctattggtgcacctggtgaagaggagaacagaggcgctgtctacatatttcacggagcc
tcgagacaggacgttgctccctcacccagtcagaggatttcaggatcccagatcccctcc
aggcttcaatattttgggcagtcactgagtgggggccaggacctcacccgggatggactg
gtggatctggctgtgggctccaagggacgcgtgctgttgctcaggaccaggccgattctt
agagtgtcaccaactgttcacttcacacctgcagagatttccaggtctgtgtttgagtgt
caggagcaggtgacccctgagcagaccctgggtgatgccactgtttgccttcatatttat
gaaagccccaagacccaacgaggtgacctccaaagtactgtcacctttgatctggctcta
gaccatggccgtctgagtccccgggccatcttcaaggagacaaagacctggactctgact
cgagttaaaacccttggtctgaacaaatactgtgaaagtgtgaagttgcttctcccggcc
tgtgtggaggactcagtgaccccaatcactcttcgcctcaactactctcttgttggcgtg
cccatccgttccttacaaaatctccaacccatgctggctgtagatgatcaaacgtacctc
acggcctctcttccctttgagaagaactgtggagctgaccatatctgccaagatgacctt
agcatcatatttggcttcccagacttgaagaccctggtggtaggaagtgacctggagctg
aatgtaggtgtgacggtgtctaatgatggagaagattcctacggaaccacagtcactctg
ttctacccagtgggtctgtcctttagacgagttgcagaaggccaagtattccttcggaag
aaagagaaccagcagtggcagcggcgtgggcagcactccctgcacctcatgtgtgacagc
accctagaccggagtcagggcctctggagcaccagctgcagcagcagacatgtcattttc
cgtggaggctcacagatgactttcttggtaacttttgacgtctcccccaaagctgagctg
ggggaccggctgcttctaagagccagagtgagaagtgagaatagcgtacctgggacccaa
aaacccacctttcagttggagcttccagtaaaatacgccgtgtatgccgtgatcagcagc
catgaccaatttaccaagtatcttaacttctcaacctcagaaaaggagaagaccagtgtg
atcgaacatagattccaggtgaataatctgggacagagagacatgccagtcagcatcaac
ttttgggtgcccatagagctgaagggagaacctgtgtggacagtgatggtctcccaccct
cagaacccattcacccaatgctatcggaatagactcaagcccacacaatttgacctcctg
actcatatgcaaaagagtcccgtgctggactgctccattgctgattgcctgcacctccgc
tgtgacgtcccctccttgggcatcctggatgagcttgacttcattctgaagggcaacctc
agctttggctggatcagtcagacattgcagaaaaaggtgttgctcctaagtgaggctgaa
atcacattcaacacatctgtgtattcccagctgccaggacaggaggcatttctgagagca
aagacgaagacagtgctggagatgtataaggttcacaaccccgtccctcttatcgtgggc
agctcagtgggaggtctgctgctgctggctctcatcacagctatactttacaaggctggt
ttcttcaaacgtcagtacaaggagatgttggaggaagcaaatggacagtttgtctcagaa
aatgggaccccaactccccaggttgcccagtga

DBGET integrated database retrieval system