KEGG   Mus pahari (shrew mouse): 110327286
Entry
110327286         CDS       T05929                                 
Symbol
Tyr
Name
(RefSeq) tyrosinase isoform X1
  KO
K00505  tyrosinase [EC:1.14.18.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00350  Tyrosine metabolism
mpah01100  Metabolic pathways
mpah04916  Melanogenesis
Module
mpah_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    110327286 (Tyr)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110327286 (Tyr)
Enzymes [BR:mpah01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     110327286 (Tyr)
SSDB
Motif
Pfam: Tyrosinase
Other DBs
NCBI-GeneID: 110327286
NCBI-ProteinID: XP_021061783
Ensembl: MGP_PahariEiJ_G0013188
LinkDB
Position
1:complement(58796685..58866329)
AA seq 531 aa
MFLPVLYCLLWSFQISDGHFPRACASSKNLLAKECCPPWMGDGSPCGQLSGRGSCQDILL
SNAPSGPQFPFKGVDDRESWPSVFYNRTCQCSGNFMGFNCGNCKFGYGGPNCTEKRLLIR
RNIFDLSVSEKNKFFSYLTLAKHTISSVYVIPTGTYGQMNNGSTPMFNDINIYDLFVWMH
YYVSRDTLLGGSEIWRDIDFAHEAPGFLPWHRLFLLLWEQEIQELTGDENFTVPYWDWRD
AENCEICTDEYLGGRHPENPNLLSPASFFSSWQIICSRSEEYNSHQVLCDGTPEGPLLRN
PGNHDKAKTPRLPSSADVEFCLSLTQYESGSMDRTANFSFRNTLEGFASPLTGIADSSQS
SMHNALHIFMNGTMSQVQGSANDPIFLLHHAFVDSIFEQWLRRHHPLLEVYPEANAPIGH
NRESYMVPFIPLYRNGDFFVTSKDLGYDYSYLQEPDPGFYRNYIEPYLEQASHIWPWLLG
AALVGAVIASALSGLSSRLCHQKRKKQPQEERQPLLMDKDDYHSLLYQSHL
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgttcttgcctgttttgtattgccttctgtggagtttccagatttccgatggccatttt
cctcgagcctgtgcctcttctaagaacttgttggcaaaagaatgctgcccaccatggatg
ggtgatgggagtccttgtggccagctttcaggcagaggttcctgccaggacatccttctg
tccaatgcaccatctggacctcagttccccttcaaaggggtggatgaccgtgagtcctgg
ccctctgtgttttataataggacctgccagtgctctggcaacttcatgggtttcaactgc
ggaaactgtaagtttggatatgggggcccaaattgtacagagaagcgactcttaattaga
agaaacatttttgatttgagtgtctcagaaaagaataagttcttttcttacctcacttta
gcaaagcatactatcagctcagtctatgtcatccccacaggcacctatggccaaatgaac
aatgggtcaacacccatgtttaatgacatcaacatctatgacctctttgtgtggatgcat
tactatgtgtcaagagacacactgcttgggggctctgaaatctggcgggacattgatttt
gcccacgaagcaccagggtttctgccttggcacagacttttcttgttattgtgggaacaa
gaaatacaagaactaactggggatgaaaatttcactgttccatactgggactggagagat
gcagaaaactgtgaaatttgcacagatgagtacctgggaggtcgtcaccctgaaaatcct
aacttactcagcccagcatccttcttctcatcctggcagatcatttgtagcagatcagaa
gagtataatagccatcaggttttatgcgatggaacacctgagggaccactattacgtaat
cctggaaaccatgacaaagccaaaacccccagactcccatcttcagcagatgttgaattt
tgtctgagtttgacccagtatgaatctggatcaatggatagaactgcgaatttcagcttt
agaaacacactggaaggatttgccagtccactcacagggatagcagattcttctcaaagt
agcatgcacaatgccttacatatctttatgaatggaacaatgtctcaagtacagggatcg
gccaatgatcccatttttcttcttcatcatgcttttgtggacagtatttttgaacaatgg
ctgcgaaggcaccaccctcttttggaagtttacccagaagccaatgcacctatcggccat
aacagagaatcgtacatggttccttttataccgctctatagaaatggtgatttcttcgtt
acatccaaggatctgggatatgactacagctacctccaagagccagatccaggcttttac
agaaactatattgagccttacttggaacaagccagtcatatctggccatggcttcttggg
gcagcactggtgggagctgttattgcttcagctctgtctgggcttagcagtaggctatgc
catcagaagaggaagaagcaaccccaggaggaaaggcagccactcctcatggacaaagat
gactaccacagcttgctgtatcagagccatctgtga

DBGET integrated database retrieval system