KEGG   Mus pahari (shrew mouse): 110327515
Entry
110327515         CDS       T05929                                 
Symbol
Icam1
Name
(RefSeq) intercellular adhesion molecule 1
  KO
K06490  intercellular adhesion molecule 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04064  NF-kappa B signaling pathway
mpah04514  Cell adhesion molecules
mpah04650  Natural killer cell mediated cytotoxicity
mpah04668  TNF signaling pathway
mpah04670  Leukocyte transendothelial migration
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah05143  African trypanosomiasis
mpah05144  Malaria
mpah05150  Staphylococcus aureus infection
mpah05164  Influenza A
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05169  Epstein-Barr virus infection
mpah05323  Rheumatoid arthritis
mpah05416  Viral myocarditis
mpah05417  Lipid and atherosclerosis
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    110327515 (Icam1)
   04668 TNF signaling pathway
    110327515 (Icam1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110327515 (Icam1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110327515 (Icam1)
   04670 Leukocyte transendothelial migration
    110327515 (Icam1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110327515 (Icam1)
   05164 Influenza A
    110327515 (Icam1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110327515 (Icam1)
   05169 Epstein-Barr virus infection
    110327515 (Icam1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110327515 (Icam1)
  09174 Infectious disease: parasitic
   05144 Malaria
    110327515 (Icam1)
   05143 African trypanosomiasis
    110327515 (Icam1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    110327515 (Icam1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110327515 (Icam1)
   05418 Fluid shear stress and atherosclerosis
    110327515 (Icam1)
   05416 Viral myocarditis
    110327515 (Icam1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110327515 (Icam1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110327515 (Icam1)
   04090 CD molecules [BR:mpah04090]
    110327515 (Icam1)
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110327515 (Icam1)
   04091 Lectins [BR:mpah04091]
    110327515 (Icam1)
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110327515 (Icam1)
CD molecules [BR:mpah04090]
 Proteins
  110327515 (Icam1)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Hyaluronan
  Cell surface receptors
   110327515 (Icam1)
Lectins [BR:mpah04091]
 I-type lectins (Siglecs)
  110327515 (Icam1)
SSDB
Motif
Pfam: ICAM_N Ig_2 Ig_3 I-set V-set C2-set_2 LapA_dom DUF4396
Other DBs
NCBI-GeneID: 110327515
NCBI-ProteinID: XP_021062239
Ensembl: MGP_PahariEiJ_G0014721
LinkDB
Position
10:16337916..16349557
AA seq 532 aa
MTSTRAKPTLPLLLTLVAVVIPGPGDAQVSIQPREAFLPRGGSVQVNCSSSCTEDLSLGL
ETQWLKDELESGPNWKLFELSEIGEDSSPLCFENCGTMQSSASATITVYSFPERVELDPL
PAWQQVGKDLTLRCHVDGGAPRTQLSAVLLRGEEILSHQPVDRHTKEITYTVLASRGDHR
ANFSCHTELDLRPQGLALFSNVSKVRHLRTFDLPATNPKLDTPDLLEVGTQQKLFCSLEG
LFPASEARIYLELGDRMLTQEMTNSSDFVSAAALVEVTEEFDRTLLLRCVLELADQILET
QRTLTVYNFSAPVLTLSQLEVSEGSQVTVKCEAHSGSQVVLLSGAPPGPPTPQVQFTLNA
SPEDHKRRFFCSAALEVAGKTLFKNQTLELHVLYGPRLDETDCLGNWTWREGSQQTLKCQ
AWGNPSPKLTCRRKADGALLPVGVVKSVKREMNGTYECHAFSSHGNVTRNVHLTVLYHHE
NNLAIIILVTVLATVGLLGVVFYVYNHQRKIRIYKLQKAQEAIKLKAQAPPP
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgacttcaacccgtgccaagcccacgctgcctctgctcctgaccctggtcgccgttgtg
atccctgggcctggtgatgctcaggtatccatccaacccagagaagccttcctgcctcgg
ggtgggtccgtgcaggtgaactgttcttcttcttgcaccgaggacctaagcctgggcttg
gagactcagtggctgaaagatgagctcgagagcggacccaattggaagctgtttgagctg
agcgagatcggggaggacagcagtcccctgtgttttgagaactgtggcaccatgcagtcg
tccgcttccgctaccatcaccgtgtattcgttcccggagcgtgtggaactggatcctctg
cccgcctggcagcaagtaggcaaggacctcaccctgcgctgccacgtggacggtggagca
ccgcggacccagctctcagcagtgctgctccgtggggaggagatactgagccaccagcca
gtggacaggcacaccaaggagatcacatacacggtgctggctagcagaggcgaccacaga
gccaatttctcgtgccacacagaactggacctcaggccgcaagggctggcattgttttct
aatgtctccaaggtccggcacctccggactttcgatcttccggctaccaacccgaagctc
gacacccctgacctcctggaggtgggcacccagcagaagttgttttgttccctggaaggc
ctgtttcctgcctctgaagctcggatatacctggagctgggagaccggatgctgacccag
gagatgacaaatagcagtgactttgtgtcagccgctgccttggtagaggtgactgaggag
ttcgacagaaccctgctgctgcgctgtgttttggagctggcagaccagatcctggagacg
cagaggaccttaacagtctacaacttttcagctccagtcctgaccctgagccagctggag
gtctcagaagggagtcaagtaactgtgaagtgtgaagcccacagtgggtcgcaggtggtg
cttctgagcggtgctccgcccgggccacccaccccgcaggtccagttcacattgaatgcc
agcccggaggaccacaaacgacgcttcttttgctctgccgctctggaggtggctggaaag
accctgtttaaaaaccagaccctggaactgcatgtgctgtatggtcctcggctggacgag
acggactgcttggggaactggacctggcgagaggggtctcagcagactctgaaatgccag
gcctgggggaacccatctcctaagctgacctgcagacggaaggcagatggtgccctgctg
cccgtcggggtggtgaagtctgtcaaacgggagatgaatggtacctacgagtgccatgcc
ttcagctcccatgggaatgtcaccaggaacgtgcacctgacagtgctgtaccaccatgag
aataacttggctataatcattctggtgacagtactggccactgtgggcctcctgggagtg
gtcttttacgtttataaccaccagaggaagatcaggatatacaagttacagaaggctcag
gaggccataaaactcaaggcacaagccccacctccctga

KEGG   Mus pahari (shrew mouse): 110332367
Entry
110332367         CDS       T05929                                 
Symbol
Icam2
Name
(RefSeq) intercellular adhesion molecule 2
  KO
K06523  intercellular adhesion molecule 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110332367 (Icam2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110332367 (Icam2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110332367 (Icam2)
   04091 Lectins [BR:mpah04091]
    110332367 (Icam2)
CD molecules [BR:mpah04090]
 Proteins
  110332367 (Icam2)
Lectins [BR:mpah04091]
 I-type lectins (Siglecs)
  110332367 (Icam2)
SSDB
Motif
Pfam: ICAM_N Ig_2 ig DUF3377 Ig_3 Adhes-Ig_like
Other DBs
NCBI-GeneID: 110332367
NCBI-ProteinID: XP_021069212
Ensembl: MGP_PahariEiJ_G0018453
LinkDB
Position
14:complement(73682839..73694434)
AA seq 279 aa
MSSFACWSLSITLLVLFYSPGSGERAFEVYIWSEKQIVEATESWKINCSTSCAAPDMGGL
ETSMNKIMLEEHPQGKWKQFLISNVSKDTVFLCHFTCSGKQHSESLNISVYQPPAQVTLK
LQPPRVIVGETFTVECKVSPVKPLEWLTLSLLRGRETLKSQTFGGAETDPQEATATFNST
ALKKDGLNFSCQAELDLRPHGGYIIRSISEYQILEVYEPMQDNQMVIIIVVVSLLLFLFV
TSVLLCFIFGQHWHRRRTGTYGVLAAWRRLPRAFRTRSV
NT seq 840 nt   +upstreamnt  +downstreamnt
atgtcttcttttgcttgctggagcctgtctataacccttcttgtcctgttctacagccca
gggtccggcgagagggcctttgaggtctacatatggtctgagaagcagatagttgaagcc
acagagtcttggaaaatcaactgcagcaccagctgtgccgccccagatatgggtggtctg
gagacgtccatgaataaaataatgttggaagagcatcctcaagggaagtggaaacagttc
ttaatctcaaatgtctccaaagacacggtctttctttgccatttcacctgttcgggaaag
cagcactcggagagtctcaacatcagcgtgtaccagcctccagctcaagtcacactgaag
ttgcagcccccccgggtgattgtgggtgaaaccttcaccgttgagtgcaaggtgtcccct
gtgaagccccttgagtggctcaccctctctctgctccgtggcagagagaccctgaagagt
cagacctttgggggagcagaaactgacccccaagaggccacagccacgttcaacagcaca
gctctgaaaaaggacggtctcaacttttcctgccaggctgaactggatctacggccccat
ggtgggtatatcatccgcagcatctcggagtaccagatccttgaagtctatgagccgatg
caggacaaccaaatggtcatcatcatcgtagtggtgtcactactgctgttcttatttgtg
acatctgtcctgctgtgctttatctttggccagcactggcacagaagacggacaggcacc
tacggggtgctagctgcctggaggaggttgccccgagccttccggacacgttccgtgtga

DBGET integrated database retrieval system