KEGG   Mus pahari (shrew mouse): 110327828
Entry
110327828         CDS       T05929                                 
Symbol
Lrrc4b
Name
(RefSeq) leucine-rich repeat-containing protein 4B
  KO
K16360  netrin-G3 ligand
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110327828 (Lrrc4b)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 I-set Ig_3 ig LRR_9 V-set LRRNT Ig_2 LRR_1
Other DBs
NCBI-GeneID: 110327828
NCBI-ProteinID: XP_021062721
Ensembl: MGP_PahariEiJ_G0012883
LinkDB
Position
1:17133838..17167433
AA seq 709 aa
MAQAHIRGSPCPLLPPGRMSWPHGALLLLWLFSPPLRAGGGGVAVTSAAGGGSPPATSCP
AACSCSNQASRVICTRRELAEVPASIPVNTRYLNLQENSIQVIRTDTFKHLRHLEILQLS
KNLVRKIEVGAFNGLPSLNTLELFDNRLTTVPTQAFEYLSKLRELWLRNNPIESIPSYAF
NRVPSLRRLDLGELKRLEYISEAAFEGLVNLRYLNLGMCNLKDIPNLTALVRLEELELSG
NRLDLIRPGSFQGLTSLRKLWLMHAQVATIERNAFDDLKSLEELNLSHNNLMSLPHDLFT
PLHRLERVHLNHNPWHCNCDVLWLSWWLKETVPSNTTCCARCHAPAGLKGRYIGELDQSH
FTCYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTSVNWLTPNGTLMTHGSYRVRISVLHD
GTLNFTNVTVQDTGQYTCMVTNSAGNTTASATLNVSAVDPVTAGGPGGGGPGGGGGAGGA
GGYTYFTTVTVETLETQPGEEAQQPRGTEKEPPGPTTDGAWGGGRPDAAAPASASTTAPA
PRSSRPTEKAFTVPITDVTENALKDLDDVMKTTKIIIGCFVAITFMAAVMLVAFYKLRKQ
HQLHKHHGPTRTVEIINVEDELPAASAVSVAAAATVAGGAGVGGDSHLALPALERDHLNH
HHYVAAAFKAHYGGNPGGGCGAKGPGLNSIHEPLLFKSGSKENVQETQI
NT seq 2130 nt   +upstreamnt  +downstreamnt
atggcgcaggcccacatccgcggctccccgtgccccttgctgccgcctggtaggatgtcc
tggccccacggggctctcctgctcctgtggctcttctccccacccctgagggccggtggg
ggcggtgtggccgtgacctcagccgctggaggaggctccccgccagccacctcctgccca
gccgcctgctcctgcagcaaccaggccagccgggtgatctgcacgcggagggagctggcc
gaggtgccagccagcatccctgtcaacacccgctacctgaacctgcaagagaacagcatc
caggtgatccgcaccgacacattcaagcacctccggcacctggagatcctgcagctgagc
aagaacctggtgcgcaagatcgaggtgggagcgttcaatgggctgcccagtctcaacaca
ctggaactcttcgacaaccggctgacaaccgtgcccacgcaggcctttgagtacctgtcc
aagctccgggagttgtggctgcgcaacaaccccatcgaaagcatcccatcctatgccttc
aaccgtgtgccctcactgcgccgcctggacctgggcgagctgaagaggctggagtacata
tcagaggcggccttcgaggggctggtgaacctgcgctacctcaacctgggcatgtgcaac
ctaaaggacatccccaacctcacagcacttgtgcgcctggaggagctggagctgtcgggg
aaccggctggacctaattcgccccggctccttccagggcctcaccagcctgcgcaagctg
tggctgatgcatgcccaagtggccaccattgagcgaaacgccttcgacgacctcaagtcc
ctggaggagctgaacctgtcccacaacaacctgatgtcgctgccgcacgaccttttcacg
ccccttcaccgcctggagcgtgtccacctgaaccacaacccctggcactgtaactgtgat
gtgctgtggctcagctggtggctgaaggagacagtgcccagcaataccacatgctgcgca
cgctgccacgcgcccgcgggcctcaagggccgctacatcggcgagctggaccagtcgcac
ttcacctgctatgccccggtcatcgtggagccacccacagacctcaatgtcaccgagggc
atggcggccgagctcaagtgccgcacaggcacatccatgacgtcggtcaactggctgaca
cctaacggcacgctcatgacgcacggttcctatcgtgtgcgcatttcggtgctgcacgat
ggcactctcaacttcaccaatgtcaccgtgcaggacacgggccagtacacgtgcatggtg
acaaactcggccggcaacactactgcctcggccacgcttaacgtgtcggccgtggacccc
gtgactgcgggagggcccggtggcgggggcccggggggtgggggcggtgcagggggcgcg
ggcggatacacctacttcactacggtgaccgtggagacgctggagacgcagccgggggag
gaggcccagcagccccgaggtactgagaaggagcccccggggcccacgactgatggcgcg
tggggcggcggccggcctgatgctgcagccccggcctcggcgtccaccacggcaccagcc
ccacgctcctcgcggcccacagagaaggctttcacggtgcccatcacggacgtgacagag
aatgcgcttaaggacctagacgatgtcatgaagaccaccaaaatcatcatcggctgcttc
gtggccatcaccttcatggccgccgtgatgctggtggccttctacaagctgcgcaagcag
caccagctgcacaagcaccacgggcccacgcgcactgtggagatcatcaacgtggaggac
gagctgcccgccgcctccgctgtgtcggtggctgcggccgccacggtggctggaggcgcg
ggcgtgggtggggacagccacctggcccttccggccctggagcgagaccacctcaatcac
caccactacgtggcggccgccttcaaggcgcactacggcggcaacccgggaggcgggtgc
ggggccaagggtccgggcctcaactccatccacgaacctctgctcttcaagagcggctcc
aaggagaacgtgcaagagacacaaatctaa

DBGET integrated database retrieval system