KEGG   Mus pahari (shrew mouse): 110328114
Entry
110328114         CDS       T05929                                 

Gene name
Hhatl
Definition
(RefSeq) protein-cysteine N-palmitoyltransferase HHAT-like protein isoform X1
  KO
K24679  protein-cysteine N-palmitoyltransferase HHAT-like protein
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110328114 (Hhatl)
SSDB
Motif
Pfam: MBOAT
Other DBs
NCBI-GeneID: 110328114
NCBI-ProteinID: XP_021063140
Ensembl: MGP_PahariEiJ_G0015698
LinkDB
Position
10
AA seq 503 aa
MGIKTALPTAELGLYSLVLSGALAYAGRGLLEASQDGAHRKAFRESVRPGWEYLGRKMDV
ADFEWVMWFTNFRNIIVFALSGHVLFAKLCTMVAPQLRSWMYAVYGVLAVVGTMGPWYLL
LLLGHCMVLYVASLLGQRWLCLALGLASLASFKVDPGISWQSGFVTGTFDLQDVLFHGGS
SFTVLRCTSFALESCAHPDRRYSLADLLKYNFYLPFFFFGPIMTFDRFHAQVSQEPVRPE
GELWHIQAQAGLSAAAIMAVDIFFHFFYILTIPSDLKFASRLPDSALAGLAYSNLVYDWV
KAAVLFGVVNTVARLDHLDPPQPPKCITALYVFGETHFDRGINDWLCKYVYDHIGGDHST
VIPELAASVATFVVTTLWLGPCDIVYLWSVLNCFGLNFELWVQKLAERGPLAQMEARLSE
QMSRRVRALCGAINFWAIIMYNLVSLNSLEFTELVARRLILTGFPQTTLAVLFVTYCGVQ
LVKERERSLALEEEQRQDKEKLE
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgggcatcaagacagcactgcccacagctgagctcggcctctactccctggtgctgagc
ggtgccctggcttatgccggccgaggtctcctggaggcatcgcaagatggggcccacagg
aaggccttccgggagtctgtgagacctggctgggagtacctgggccggaagatggatgtg
gctgacttcgagtgggtgatgtggtttaccaacttccggaacatcattgtctttgccctc
tctggacacgtgctgtttgccaaactctgcacgatggtggccccccagctccgctcctgg
atgtatgctgtgtatggagtcctggctgtggtgggcacaatgggcccatggtacctgctg
ctgctgcttggccactgtatggtcctctatgtggcctcactcttgggccagcgctggctg
tgccttgcccttggtctggccagcctggcgtccttcaaggttgaccctgggatctcttgg
cagagtgggtttgtaacaggcacctttgatcttcaagacgtactgttccacggcggcagc
agcttcacagttctgcggtgcactagcttcgccctggagagctgcgctcaccccgaccgt
cgctactcccttgctgacctgctcaaatacaatttctacttgcccttcttcttcttcggg
cccatcatgaccttcgaccgcttccatgctcaggtgagccaggagccagtgaggccagag
ggcgagctgtggcacatccaggcccaggcaggactcagcgcggcagccatcatggccgta
gacatcttcttccacttcttctacatcctcaccatccccagtgatctcaagttcgccagc
cgcctcccagacagtgctcttgcgggcctggcgtactcaaacctggtgtatgactgggtg
aaggcagcagtcctgtttggtgttgtcaacactgtggcacgcctggaccacctggaccct
cctcagcctcccaagtgcattaccgcactctatgtcttcggggaaacgcacttcgaccgt
ggtatcaatgactggctttgcaaatatgtgtatgaccacattggcggggatcattccacc
gtgatcccagagctggccgcgtccgtggccactttcgtcgtcaccaccctgtggctcggg
ccttgtgacatcgtctacctgtggtctgttcttaactgcttcggcctcaactttgagctc
tgggtacagaagctggcagagcgtgggccactggcacagatggaggcccggctatcggag
cagatgtctcggagggtccgggccctctgcggggccataaatttctgggctatcatcatg
tacaacctcgtgagcctgaacagccttgaattcacagagctggttgcccgacgcctgata
cttacaggcttcccccagaccacactggcggtcttgtttgtcacctactgtggtgtccag
ctggtaaaggagcgtgagagatccctggcattggaggaggagcagcggcaggacaaggag
aagctggagtag

DBGET integrated database retrieval system