KEGG   Mus pahari (shrew mouse): 110328145
Entry
110328145         CDS       T05929                                 
Symbol
Casp1
Name
(RefSeq) caspase-1
  KO
K01370  caspase 1 [EC:3.4.22.36]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04217  Necroptosis
mpah04613  Neutrophil extracellular trap formation
mpah04621  NOD-like receptor signaling pathway
mpah04623  Cytosolic DNA-sensing pathway
mpah04625  C-type lectin receptor signaling pathway
mpah05014  Amyotrophic lateral sclerosis
mpah05132  Salmonella infection
mpah05133  Pertussis
mpah05134  Legionellosis
mpah05135  Yersinia infection
mpah05164  Influenza A
mpah05171  Coronavirus disease - COVID-19
mpah05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110328145 (Casp1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110328145 (Casp1)
   04621 NOD-like receptor signaling pathway
    110328145 (Casp1)
   04623 Cytosolic DNA-sensing pathway
    110328145 (Casp1)
   04625 C-type lectin receptor signaling pathway
    110328145 (Casp1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110328145 (Casp1)
   05164 Influenza A
    110328145 (Casp1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110328145 (Casp1)
   05135 Yersinia infection
    110328145 (Casp1)
   05133 Pertussis
    110328145 (Casp1)
   05134 Legionellosis
    110328145 (Casp1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    110328145 (Casp1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110328145 (Casp1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110328145 (Casp1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110328145 (Casp1)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.36  caspase-1
     110328145 (Casp1)
Peptidases and inhibitors [BR:mpah01002]
 Cysteine peptidases
  Family C14: caspase family
   110328145 (Casp1)
Membrane trafficking [BR:mpah04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    110328145 (Casp1)
SSDB
Motif
Pfam: Peptidase_C14 CARD
Other DBs
NCBI-GeneID: 110328145
NCBI-ProteinID: XP_021063172
Ensembl: MGP_PahariEiJ_G0014622
LinkDB
Position
10:1808517..1817819
AA seq 402 aa
MADKILRAKRKQFINSVSTGTINGLLDELLEKRVLNQEEMDKIKLANVTVMDKARDLCDH
VSKKGPQASQIFITYICNEDCYLAGILELQSGPSAETSVATEDSKGGYPSSSETKEEQNK
DCGTCSELTGSLKFCPLEKAQKIWKENSSEVYPIMNTSTRTRLALIICNTEFQHLSRRVG
AHVDLREMNLLLQDLGYTVKVKENLTALEMVKEVKEFAACPEHKTSDSTFLVFMSHGIQE
GICGTTYSNEVSDILKVDTIFQMMNTLKCPNLKDKPKVIIIQACRGEKQGVVLLKDSVGD
SEKEFLTDAVFEDDGIKKAHIEKDFIAFCSSTPDNVSWRHPVRGSLFIECLIKHMKEYAW
SCDLEDIFRKVRSSFEKPEYRLQMPTAERVTLTKRFYLFPGH
NT seq 1209 nt   +upstreamnt  +downstreamnt
atggctgacaagatcctgagggcaaagaggaagcaatttatcaactcagtgagtacaggg
acaataaatggattgctggatgaacttttagagaagagagtgctgaatcaggaagaaatg
gataaaataaaactagcaaacgttactgttatggacaaggcacgggacctatgtgatcat
gtctctaaaaaagggccccaggcaagccaaatctttatcacttacatttgtaatgaagac
tgctacctggcaggaattctggagcttcaatcaggtccatcagccgaaacatctgttgct
acagaagattctaagggaggatatccttcatcctcagaaacaaaggaagaacagaacaaa
gactgtggcacatgttcagaactgactgggagcctcaagttttgccctttagaaaaagcc
cagaagatatggaaagaaaattcttcagaggtttatccaataatgaatacgagcactcgt
acacgtcttgccctcattatctgcaacacagagtttcaacatctttctcggagggttgga
gctcatgttgacctcagagaaatgaatttgcttctgcaggatctggggtataccgtgaaa
gtgaaagaaaatctcacagctctggagatggtgaaagaggtgaaagaatttgctgcctgc
ccagagcacaagacttctgacagtactttccttgtattcatgtctcatggtatccaggag
ggaatatgtgggaccacatactctaatgaagtttcagatattttaaaggtggacacaatc
tttcagatgatgaacactttgaagtgcccaaacttgaaagacaagcccaaggtgattatt
attcaggcatgccgtggagagaaacaaggagtggtgttgttaaaagattcagtaggcgac
tctgaaaaggaatttttaacggatgcagtttttgaagatgatggcattaagaaggcccat
atagagaaagattttattgctttctgctcttcaacaccagataatgtgtcttggcgacat
cctgtccggggctcacttttcattgagtgtctcatcaaacacatgaaagaatatgcctgg
tcttgtgacttggaggacattttcagaaaggttcgatcttcattcgaaaaaccagaatat
aggctacagatgcccaccgctgaaagggtgaccctgacaaaacgtttctacctcttccca
ggacattaa

DBGET integrated database retrieval system