KEGG   Mus pahari (shrew mouse): 110328167
Entry
110328167         CDS       T05929                                 
Symbol
Casp7
Name
(RefSeq) caspase-7
  KO
K04397  caspase 7 [EC:3.4.22.60]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04210  Apoptosis
mpah04215  Apoptosis - multiple species
mpah04668  TNF signaling pathway
mpah04932  Non-alcoholic fatty liver disease
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05132  Salmonella infection
mpah05133  Pertussis
mpah05134  Legionellosis
mpah05200  Pathways in cancer
mpah05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    110328167 (Casp7)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110328167 (Casp7)
   04215 Apoptosis - multiple species
    110328167 (Casp7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110328167 (Casp7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110328167 (Casp7)
   05133 Pertussis
    110328167 (Casp7)
   05134 Legionellosis
    110328167 (Casp7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110328167 (Casp7)
   05022 Pathways of neurodegeneration - multiple diseases
    110328167 (Casp7)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110328167 (Casp7)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110328167 (Casp7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110328167 (Casp7)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.60  caspase-7
     110328167 (Casp7)
Peptidases and inhibitors [BR:mpah01002]
 Cysteine peptidases
  Family C14: caspase family
   110328167 (Casp7)
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 110328167
NCBI-ProteinID: XP_021063207
Ensembl: MGP_PahariEiJ_G0014577
LinkDB
Position
1:167488246..167527472
AA seq 303 aa
MTDDQDCAAELEKVDSSNEDRVDAKPDRSSVIASVFSKKKKNASVDPVRTGRDRVPTYLY
RMDFQKMGKCIIINNKNFEKATGMGVRNGTDKDAGALFKCFQNLGFEVTVHNDCSCAKMQ
DLLRKASEEDHSNSACFACVLLSHGEEDLIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKL
FFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRNPGKGSW
FVQALCSILNEHGKDLEIMQILTRVNDRVARHFESQSDDPRFNEKKQIPCMVSMLTKELY
FSR
NT seq 912 nt   +upstreamnt  +downstreamnt
atgactgatgatcaggactgtgccgcggagctggaaaaggtggattcttccaacgaagac
agagttgacgccaagccagaccgctcctctgtcatcgcctccgttttctcgaagaagaag
aaaaatgcctctgtggaccccgtcaggaccggccgggaccgagtgcccacttacctgtac
cgcatggatttccagaagatgggtaaatgcatcattataaacaacaagaacttcgaaaaa
gcaacaggtatgggcgtccggaatgggacggacaaagacgcaggggccctcttcaagtgc
ttccaaaacctgggttttgaagtaaccgtccacaatgactgctcttgtgcaaagatgcaa
gatctgcttagaaaagcctctgaggaggaccacagcaactcagcctgcttcgcctgcgtc
ctgctaagccacggagaagaggatctgatttatgggaaggatggcgtgacacccataaag
gatctgacagctcattttaggggagacagatgcaaaaccctgttagagaaacccaaactc
ttcttcattcaggcgtgccgagggacggagctcgatgacggaatccaggctgactcgggg
cccatcaacgacactgacgctaatccccgctacaagatcccagtggaagctgacttcctc
tttgcttactccacggttccaggttattactcgtggaggaacccagggaaaggctcctgg
tttgtgcaggccctctgctccatcctgaatgagcatggcaaggacctagagatcatgcag
atcctgaccagggtgaacgacagggtggccaggcacttcgagtcccagtctgatgatccg
cgcttcaacgagaagaagcagattccgtgtatggtgtccatgctcaccaaagagctgtac
ttcagccgctga

DBGET integrated database retrieval system