KEGG   Mus pahari (shrew mouse): 110328543
Entry
110328543         CDS       T05929                                 
Symbol
Cadm1
Name
(RefSeq) cell adhesion molecule 1 isoform X1
  KO
K06781  cell adhesion molecule 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110328543 (Cadm1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mpah04515]
    110328543 (Cadm1)
Cell adhesion molecules [BR:mpah04515]
 Immunoglobulin superfamily
  Necl family
   110328543 (Cadm1)
SSDB
Motif
Pfam: Ig_3 Ig_2 I-set ig V-set C2-set_2 C1-set Ig_C17orf99 Syndecan Adhes-Ig_like
Other DBs
NCBI-GeneID: 110328543
NCBI-ProteinID: XP_021063616
Ensembl: MGP_PahariEiJ_G0015032
LinkDB
Position
10:42666297..42991618
AA seq 475 aa
MASAVLPSGSQCAAAAAVAAAAAPPGLRLRLLLLLLSAAALIPTGDGQNLFTKDVTVIEG
EVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSVS
DEGRYFCQLYTDPPQESYTTITVLVPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTI
RWFKGNKELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYL
EVQYKPQVHIQMTYPLQGLTREGDAFELTCEAIGKPQPVMVTWVRVDDEMPQHAVLSGPN
LFINNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDPPTTIPPPTTTTTTTTTTTTTTILT
IITDTTATTEPAVHGLTQLPNSAEELDSEDLSDSRAGEEGTIGAVDHAVIGGVVAVVVFA
MLCLLIILGRYFARHKGTYFTHEAKGADDAADADTAIINAEGGQNNSEEKKEYFI
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggcgagtgctgtgctgccgagcggatcccagtgtgcggcggcagcggctgtggcggcg
gcggcggcgcctccagggctccggctccggctcctgctgttgctcctttcggccgcggca
ctgatccccacaggtgatggacagaatctgtttactaaagacgtgacagtgattgaagga
gaagtggcaaccatcagctgtcaagtcaataagagtgacgactcagtgatccagctcctg
aaccccaacaggcagaccatctacttcagggacttcaggcctttgaaggacagcaggttt
cagctgctgaatttttctagcagtgaactcaaagtgtcactgacgaatgtctcagtctcg
gatgaagggaggtacttctgtcagctctacacggaccccccacaggagagttacaccacc
atcacagtcctggtccctccacgtaacttgatgatcgatatccagaaagacacggcagtc
gaaggggaggagattgaagtcaactgtactgccatggccagcaagccagcgacgaccatc
aggtggttcaaagggaacaaggaactcaaaggcaaatcagaggtggaagagtggtcagac
atgtacactgtgacgagtcagctgatgctgaaggtgcacaaggaggacgatggggtccca
gtgatctgccaggtggagcaccctgcggtcactggaaacctgcagacccagcgctatcta
gaagtgcagtataaaccgcaagtgcatattcagatgacttaccctctgcaaggcctaacc
cgcgaaggggatgcgttcgagttaacgtgtgaagccatcgggaagccccagcctgtgatg
gtaacttgggtgagagtcgatgatgaaatgcctcaacatgccgttctgtctggaccaaac
ctgttcatcaataacctaaacaaaacagataacggtacttaccgctgtgaggcttccaac
atagtgggaaaggcacattcggactatatgctgtatgtatacgatccccccacaactatc
cctcctcccacaacaaccaccactaccaccaccaccaccaccaccaccaccatccttacc
atcatcacagacaccacggcgacgacagaaccagcagttcacggccttactcagttgccc
aattccgcagaagaactggacagtgaggatctctcagattctcgagcaggtgaagagggg
accattggggcagtggaccacgcagtgattggcggcgtcgtggccgtggtggtgtttgcc
atgttatgcttgctcatcattctgggccgctattttgccagacataaaggtacatacttc
actcatgaagccaaaggagccgatgacgcagcagacgcagacacagctataatcaatgca
gaaggaggacagaacaactcggaagaaaagaaagagtacttcatctag

DBGET integrated database retrieval system