KEGG   Mus pahari (shrew mouse): 110328863
Entry
110328863         CDS       T05929                                 
Symbol
Vcan
Name
(RefSeq) versican core protein isoform X1
  KO
K06793  versican core protein
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110328863 (Vcan)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:mpah00535]
    110328863 (Vcan)
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110328863 (Vcan)
   04091 Lectins [BR:mpah04091]
    110328863 (Vcan)
Proteoglycans [BR:mpah00535]
 Extracellular matrix (ECM) proteoglycans
  Aggrecan / versican family
   110328863 (Vcan)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   110328863 (Vcan)
Lectins [BR:mpah04091]
 C-Type lectins
  Group 1: Proteoglycan core proteins
   110328863 (Vcan)
SSDB
Motif
Pfam: Xlink V-set Lectin_C EGF hEGF Sushi ig I-set EGF_2 EGF_CA
Other DBs
NCBI-GeneID: 110328863
NCBI-ProteinID: XP_021064017
Ensembl: MGP_PahariEiJ_G0015834
LinkDB
Position
11:complement(20691133..20783565)
AA seq 3340 aa
MLINMKGILWMCSTLLLTHALHKAKMETSPPVKGSLSGKVVLPCHFSTLPTLPPNYNTSE
FLRIKWSKMEVDKNGKDIKETTVLVAQNGNIKIGQDYKGRVSVPTHPDDVGDASLTMVKL
RASDAGVYRCDVMYGIEDTQDTMSLAVDGVVFHYRAATSRYTLNFAAAQQACLDIGAVIA
TPEQLFAAYEDGFEQCDAGWLSDQTVRYPIRAPREGCYGDMMGKEGVRTYGFRSPQETYD
VYCYVDHLDGDVFHITAPSKFTFEEAEAECTNRDARLATVGELQAAWRNGFDQCDYGWLS
DASVRHPVTVARAQCGGGLLGVRTLYRFENQTCFPLPDSRFDAYCFKPKQNISEATTIEM
NILAETSSPSLSKEPHMVPDRATPVIPLATELPIFTTHFPPAGNIVNSEQKSVVYFQATT
DRLATESPTTAGNTINSWDVDDYLASGSGPLGMPDISEIKEEGLQSTTVISQHATGSQDG
VIEDMQTHESVTKIEQIEVGPLVTSMEITNHISLKEFPEIKTPFESTEVTLEHTTEMPTV
STSPELATTSHYGFTLREDDGEDRTLTVRSDQRTRAFSQIPEVITVSKTSEDTTYSQLGD
LESISTSTITMLGTDRSLIDKEKEPKTNSKMTEDEFGQSQHTTTFPSQHLTEGELLPYSG
DTTSVERISTVIYPSLQTDVTQGRERTETPRPELKKDPYTVDEILEKVTKDPFIGKTEEV
FSGMPLSTSSSESSVERTESVSPELTIEKLAVKPTEARDVEEMTILTRLETDVTKSDKDV
TRVHLTHSTLNVEVVTVSKWPGDEDNSTSKPLPSTEHTGFTKLPPVSLSTIGISGEDKEI
PSFTDGGDEYTLFPDGTLKPLEKVSEEDLASGELTVTFRTSTSIGSTEKSASGEPTTGGR
FLPTTSTEDQVINATVEGSALGEDTEASKPLLTGPPFVHTSDVEELAFVNYSSTQEPTTY
VDISHTSPLSIIPKTEWRVLETSVPLEDEVLGKSDQGILEQTHLEVTMSPEALRTTGVSQ
GETQEESQPPGSPFPTFNSTAVMAKETTAFEEGEGSTYTLSEDRLMTSSERVPGLEATPV
GTSYPPGAITDQEVEMDTMVTLMSTIRPTMVSSTEPKVIYEAEGSSPTEFASTLRPFQTY
VTQLMEETTEEGKKAPLDYTDLGSGLFEPRATELPKLPTAPSDISDFTAINSLHITPSSR
PSSSFTEEPRVFEKEPSEKTTGDILPGESVTQHPVTTLIDIVAMKTESDIDHMTSKPPVT
QPTRPSVVERKTTFKPQELSTSTPPAGTKFHPDINVYIIEVRENKTGRLSDMIVSGHPID
SESKEEEPCSEETDPLHDLFAEILPELPDSFEIDIYHSEEDEDGEEDCVNATDVTTTPSV
QYINGKQLVTPVPKDPEAAEARRGQYESVAPSQNFSDSSATDTHQFILAETELSTTMQFE
KSKEGTELLEITWKPETYPETPDHVSSGEPDVFPTLSFHDGKTTKWSESITESNPNLENP
VNKQPNPIPLFPEESSGEGAIEQASQKTIFSRATEVALGKETDQSPTISTSSILSSSVSV
NVLEEEPITLTGISPTDESMSTVESWVEITPSQTVEFSGSSSAPIIEGSGEVEEYKNKIF
NVVTDLPQRDPTDTLSPLDMSKIMITSHHIYIPATTDPLDSKLPLPEASPTQFGIQTATS
EGVSDKSFEGRKREEEKEGAVNAAHRGEVEAATERSDHLLLAPELESSNVAASSDLATWE
GFMPETTPTESETIGVANVEAQPFEHSSSSQPRVQEELTTLSGNPPSLFMDLGSGDASSD
MELITTSLFTLDLDSETKVKKELPSTPSPSVEISSSFEPTGLTPSTVLDIESAGVMSQTL
QKTLISEISEKPTSQSEVRDLYTGFPLGEDFSGDFSEYPTVSYPTMKEETVGMRGYEDEE
IRDTQTSSSIPPTSDINPVPDSKGLGSTVASTTAFPWDEIMTSAEGSGEQLASVRSSVGP
VLPLAVDIFSGTESPYFDEELEEVAAVTEANERSTALPTAASGNSVDLTENGYIEVNSTM
SVDFPQTTEPAKLWSKPEVDTEKQEIGRETVTKENAQGQKTFESFHSSLAPEQTILETQS
LIETEFQTSDYSMLTTMKTYITNKEVEEEGMSIAHMSTPGPGIKDLESYTTHPEATGESH
SFSATALVTESGPARRVVMESSTQEEESIKLFQKGVKLTNKESNTDLSFSGLGSGEALSP
LPTTSVSLTDMEQIISTLYTETSHMESLGTSILGDKVEDHEKIEDVSNEVRTLIPETGSV
LQHSTEALNTTLSDSGTEESTTSTLPFMKLMDLEHSPKQTLRWEEEIQTHRPQTMTGLIS
NENSSASEAEEAATSPTAFLPQTYSVEMTKHFAPSESQPSDLFNGNSGEGSGEVDTLDLV
YTSGTTQASSQGDSTFASHGFLEKHPDVSKTEAGATEGSPTASAMFLHHTEYKSSRYPAS
TLPSTESYKSPSEGMADGLQDHIQFEGSTLKPSRRKTTESIIIDLDKEDSKDLGLTITES
AIVEILPELTSDKNIIIDIDHTKPVYEYIPGIQTDLDPEIQFGSHGSNEESLQVQEKYEA
AVTLSPTEETFEGSGDALLAGYTQAIYNESVTPNDGKQAEDISFSFVTGTPVSSTETELD
TFFPTVSTLHIPSKLTTASPEIDKTNIEAISLDDIFESSTLSDGQAIADQSEVISTLGHL
EKTQEEYEEKKYGGPSFQPEFFSGVGEVLTDPPAYVSIGSTYLIVQPLTELPNVVGPSDS
THYTEETPAVSSMAELSSQIPSSPFPGYIDSGVSKFPEVPHTSAQPVPTATSSQKSIEGP
FKEVRANVEATIKPLGGNVHRTEPPSMSPDPALDISEDKSEPKLLEELETSPTKPETSQD
FPNKANDQIPEETVGMLAAIRTTESEPVITAAGDMELGGATQQPHSASAAFRVETGVVPQ
PIPQEPDRPTFPSLEINHETHTSLFGDSILATSEKQVSQKILDYSNQATVSTLDLHTAHA
LPPFSILDNSNETAFLIGISEESVEGTAVYLPGPDLCKTDPCLNGGTCYPTETSYVCTCA
PGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKF
QGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHD
FRWTDGSALQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVAC
GQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAMPKITCMNPS
AYQRTYSKKYLKNSSSAKDNSINTSKHEHRWSRRWQETRR
NT seq 10023 nt   +upstreamnt  +downstreamnt
atgttgataaatatgaaaggcatcttatggatgtgctcaaccttattattaacccatgca
ctacataaagccaaaatggaaacaagcccacctgtcaaaggctctctgtctggaaaagtg
gtcctaccttgtcatttttcgaccttgcctaccttaccacccaattacaacacgagtgaa
tttctcagaatcaaatggtctaagatggaagtggacaaaaatggaaaggatataaaggag
acgactgtcctggtggcccagaacggaaatatcaagattggtcaggactacaaggggcga
gtgtcagtgcctacacatcccgatgatgtaggtgatgcctccctcaccatggtcaaactc
cgggctagtgacgcaggtgtctaccgatgtgatgtcatgtatgggattgaagacactcag
gacaccatgtcactggctgtggatggagttgtgtttcactacagggcagccaccagcaga
tacactctgaactttgccgctgctcaacaggcttgtttggatatcggggcggtcatagca
accccagagcagctgtttgctgcctatgaggatggatttgagcagtgtgatgcaggatgg
ctgtccgatcaaactgtcagatatcccatacgggctccccgagagggctgttatggagac
atgatggggaaggaaggggtccggacctatggattccgctctccccaggaaacctatgat
gtgtactgttatgtggatcatctggatggtgatgtgttccatatcactgctcccagtaag
ttcaccttcgaggaggccgaagcagagtgtacaaacagggatgcgaggctggcgactgtt
ggagaacttcaggcagcttggagaaatggctttgaccaatgcgattacggctggctgtcg
gatgccagtgtgcggcaccctgtgactgtggccagggcccagtgtggaggaggtctactt
ggggtgagaaccctgtatcgttttgagaaccagacatgcttccctctccctgatagcaga
tttgatgcctactgctttaaacctaaacagaatatatcagaggcaactaccatcgaaatg
aatatcctcgcagaaacttcatcacccagtttatctaaagaaccacacatggtacctgac
agagctacaccagtcattccattagccaccgaattacctatttttaccacacacttccct
cctgcaggaaatatagtcaattctgaacagaaatctgtagtctattttcaggctaccaca
gacagattagccactgaatcacccacaactgctgggaataccatcaactcttgggatgtg
gatgactacttggcttctgggtcagggccacttggaatgccagacatatctgaaattaag
gaggaaggactccaaagtacaactgtcatctcccaacatgctactggctcacaggatgga
gttatagaggatatgcaaacacatgaatccgttacaaagattgaacaaatagaagtgggc
cccttagtaacatccatggaaatcacaaatcacatttctctcaaagaatttccagaaatc
aaaacaccatttgaatccacagaagtgaccctggaacatacgactgaaatgccaacagtg
agcaccagtcctgaattggcaaccacaagtcactatggattcaccttgagagaagatgat
ggagaagacagaacactgacagttagatctgatcagagaacccgggcctttagccaaatc
cccgaagtcatcacggtatcaaaaacatcagaagacactacctactcgcagctaggggac
ttagagtccatttcaacatcaacaataaccatgcttggcacagatagatcactgatagat
aaagagaaagaacccaaaactaatagtaagatgactgaagatgagtttggtcaatcacag
catacaaccaccttcccatcacagcatcttacagaaggagaattacttccatattctggt
gacacaacatcagtagagagaatatccacagttatttatccatcattacaaacagatgtg
acacaaggaagagagagaacagaaacaccaagaccagagttgaaaaaagatccttacaca
gttgatgaaatactagaaaaggtcaccaaagatccatttataggtaaaacagaagaagtc
ttctctggaatgcctctctctacatcttcctcagagtcttcagtggaaaggacagagtct
gtttccccagaattgacaattgagaagttagctgtgaagccaacagaagcaagagatgtg
gaagaaatgacaatcctgactagattagaaacagatgttacaaagtctgacaaagatgtt
acaagagttcatttgacccacagtactttaaatgtggaagtggtcacagtatcaaaatgg
ccaggggatgaagataattcaacttcaaagcctttaccctcaacagaacatacaggcttt
acaaaattgcctcctgtctcacttagtactataggaataagtggagaagataaagaaatc
ccaagtttcacagatggaggagatgaatacacccttttcccagatggtactctaaaacca
ttagaaaaggtttctgaagaagatttagcatctggagaattgacagtcacctttcgtaca
tctacatcaattggcagcacagaaaagtcagcttccggagagcctacaactggaggtagg
tttctgcccaccacaagcacagaagaccaggtcatcaatgcaactgtggaaggaagtgct
ttgggtgaagatacagaagcctccaagccattacttactggccccccgtttgtccacacc
tctgatgtggaagaattggcatttgttaattatagtagcactcaggagcccactacttat
gtagacatatcccatactagtcctctttctataattcccaagacagaatggcgtgtattg
gaaacttctgttccactagaagatgaggttctaggcaaatctgatcaaggtatccttgaa
cagactcatctagaagtaaccatgtctcctgaagctttgagaacaacaggagtttcacag
ggagaaacccaggaagaatcacaacccccagggagcccatttcctactttcaattctact
gcagttatggccaaggagacaacagcatttgaagagggggagggatcaacatatactctc
tctgaagacagattgatgacaagttctgaaagagtcccaggtttagaagcaactccagtt
ggtacatcttatccacctggtgcaataacagaccaagaagtggaaatggatacaatggta
acactgatgtcaaccattaggccaacaatggtttcaagtacagagccaaaagtaatttat
gaagcagaaggtagtagtccaacagaatttgcatcaactttgaggcccttccagacttat
gtcacacagcttatggaagaaactaccgaggaaggaaaaaaggcacccttagattataca
gatttaggctcagggttatttgaacccagagccaccgagctcccaaaacttccaacagct
ccaagtgatatcagtgactttactgccatcaacagccttcacataacgccgtcctcgagg
ccatcttcatcattcactgaggaaccacgtgtctttgagaaggagcccagtgagaaaaca
acaggtgacatacttcctggagaatctgtaacacagcatcccgtgacaactctcattgat
attgtagccatgaaaacagaatctgatattgatcacatgacctcaaaacctcctgtaaca
cagccaacaagaccatcagttgtggaaagaaaaacaaccttcaaacctcaagagttgtct
acttcaacacctccagcagggaccaagttccaccctgacataaatgtttatattattgag
gtcagagaaaacaagacaggtcgattgagtgatatgattgtaagtggtcatccaatagat
tcagaatctaaagaagaggaaccttgcagtgaagaaacagatccactgcatgatctgttt
gctgaaattttacccgagttaccagattcatttgaaatagacatatatcacagtgaggaa
gatgaagacggagaggaggactgtgtaaatgcaaccgatgtaacaactactccatcagtg
cagtatatcaatgggaagcagctggttaccccagtgcccaaggacccagaagctgcagaa
gctaggcgtggccagtacgaaagtgttgcaccttctcagaatttctcagatagctctgca
actgacacccatcagtttatactggcagaaacagaattgtcaactaccatgcaatttgag
aaatctaaagaaggcactgaattgttagaaatcacatggaaacccgagacttaccctgaa
acaccagaccatgtttcaagtggtgagcctgatgttttccctacactatcattccatgat
ggtaaaaccaccaaatggtcagagtccatcacagagagcaatccaaaccttgaaaatcca
gtgaacaaacaacctaatcctatacctctgtttcctgaagagtcttcaggagagggtgcc
attgaacaagcatcccagaaaacaatcttctctagggctacagaagtagcacttggtaaa
gagacagaccaaagtcctaccatatctacctcaagcatactttcaagctctgtgtcagta
aatgtcttggaggaagaaccaattactctaacaggaatctcaccgactgatgaatccatg
tctaccgtagaaagctgggtagagataacacctagccaaactgtagagttctcggggagt
tcttcagctcctattattgaagggtctggggaagtagaagaatataaaaataaaatcttt
aacgtggtaactgatttaccacagagagatcctacagatacactcagccccttggatatg
agcaagataatgatcacaagccatcacatttatattcctgcaaccactgatcctttggat
tcaaaactacctttgccagaggcaagccctacacaatttggaattcaaacagccacctct
gagggggtttctgataagtcttttgaaggaagaaaaagagaagaagagaaagagggagct
gtgaatgcagcccacagaggagaagttgaagcagcaacagagaggtcagaccacttactt
ttagccccagaattagaaagttcaaatgtagctgcatctagtgatttggctacctgggaa
ggttttatgccagagacaacacccacggagtctgaaacaattggtgtagccaatgtggag
gcacagccctttgagcatagcagtagtagtcagcctagggtccaggaagagctcacaact
ctctcaggaaatcccccctctctttttatggacctgggctcaggagatgctagtagtgat
atggaactcatcactacttctttatttacattagatttagactctgaaaccaaagtcaaa
aaggaattacccagtactccatctcccagtgttgagatatcatcctcttttgagccaaca
ggattaaccccgagtactgtactagacatagaaagtgctggagttatgagccagacattg
cagaagacactgatttctgaaatatcagaaaagccaacttcccagtcagaagtaagggat
ttatatacaggttttcctttgggagaagattttagtggtgacttcagtgaatatccaaca
gtgtcttatccaacaatgaaagaggaaacagtagggatgcgaggctatgaggatgaagaa
attagggatacacagacttcatcatctataccgcctacctcagacatcaacccagtgcct
gactcaaaaggactgggcagtactgtggccagcaccacagccttcccctgggatgagatc
atgacctcagctgaggggtcaggtgagcagttggcctcagtcaggagctctgttggtcca
gtgcttccactagctgtggacattttttctggtacagagtctccatattttgatgaagag
cttgaagaagtggctgcagtgacagaagcaaatgaaagatccactgctttgccaacagca
gcgagtggaaatagtgtagatttgacagaaaatgggtacatagaggtaaatagcacaatg
tcagtggactttccccagacaacggagccagccaaattgtggtctaaaccagaagtcgat
acagaaaaacaagagattggaagagaaacagtgacaaaggaaaatgctcagggacaaaag
acttttgaatcattccacagttctcttgcgccagaacaaacaattttggaaacccaatca
cttattgaaacagaattccaaacttcagattactctatgttaacaacaatgaaaacatac
attactaataaggaagtggaagaggaaggtatgtccatagctcatatgtcaactccaggt
ccagggatcaaagacttggaatcatatacgacccatcctgaagctactggagagtcacac
tctttttcagctactgctttagtgactgaatctggaccagctagaagggtagtcatggaa
tcctcaactcaagaggaagaaagcataaaactcttccaaaagggtgtgaaactaacaaat
aaagagtcaaatactgatctctcattctctggactgggatcaggagaggctttgtctcct
ttacctaccacatcagtgagtttaactgacatggagcagatcattagcacattgtatact
gagacatctcacatggaaagcttaggaacgagcatcttaggtgataaagtggaagaccat
gaaaagattgaagatgtgtcaaatgaagttagaacactcattcccgaaacaggcagtgtc
ttgcaacacagcacagaggcactcaacacaactttgagtgatagcggaacagaagaatct
acaacttcgactcttcctttcatgaagctcatggacttggaacattctccaaagcagacc
ctcaggtgggaagaggaaatccagacccatagaccacaaactatgactggactgatctct
aatgaaaattcttcagcatcagaagctgaagaagcagcaacctcccccactgcttttctg
cctcaaacttacagtgttgaaatgaccaaacactttgctccttcagagtcacaaccatct
gacttgtttaatggaaactctggagaaggatctggagaagtggatactcttgacttagtg
tacacttctggtactactcaggcaagcagtcaaggagacagcacgtttgcttctcatgga
tttctggaaaagcatccagatgtgtcaaagactgaggctggagctactgagggctcgcca
acagcttcagcgatgttcctgcatcacacagagtacaagagttctcggtatccagctagc
acactgccaagcacagagtcatataaaagtccctcagaaggtatggcagatggtttgcaa
gaccatatccagtttgaaggttctaccttgaaacctagcagaagaaaaaccactgaaagc
attattatagatctagacaaagaggatagtaaggacctaggattgacaattactgagagt
gctatcgttgaaattctccctgagctgacatcagataaaaatattattatagacattgat
cacactaaacctgtatatgagtacatccctggaatacaaacagacttagatccagagata
caatttggatcacatggcagtaatgaagaaagccttcaagttcaagagaaatatgaggca
gctgttaccctttctccaactgaggaaacatttgagggctctggtgatgcacttcttgct
ggctacactcaagcaatatacaatgagtctgtgactcccaatgatggaaagcaggcagag
gacataagctttagttttgtcactgggaccccagtttctagcacagagacagaattagac
actttcttccccacagtgtcaaccctgcacattcctagtaaactaaccacagctagtcca
gagattgataaaaccaacattgaagcaatatctctggatgatatatttgaatcaagcacc
ttgtctgatggccaagctatagcagaccagagtgaagtaatatcaacattggggcatttg
gaaaaaacacaagaagaatatgaagaaaagaaatatggaggtccttcatttcagccagaa
ttcttttcaggagtaggggaagtattaacagatccccctgcttatgtaagtattggtagt
acataccttatagttcagcctttaacagaattgcccaatgtggtaggaccatctgactcc
acacattacactgaagaaacacctgcagtttcctctatggcagagctctcttctcagata
ccatcttcccccttccctggctacatagacagtggagtctctaaattcccagaggttccc
catacaagtgctcagccagttcctactgccacctcatcacaaaagtctatagagggtcct
tttaaggaagtccgtgctaatgttgaagcaaccatcaagccattgggtggaaatgtccac
agaacagagcctccatccatgtctcctgaccctgctttagacatttctgaagataaaagt
gagcctaagttactagaagaactcgagacttctcccacaaaacctgagacttcccaagac
ttcccaaacaaagcaaatgatcagattccagaagaaacagttggtatgcttgctgctatc
agaacaacagagagtgaacctgtcattactgctgcaggtgacatggagctaggaggtgcc
acacagcagccacattctgcttctgcagctttcagagttgagacaggtgtggtacctcag
cccatcccacaggagcctgacaggccaacctttccttccttggaaattaaccatgaaaca
catacatcattatttggagactctatactggcaacatctgaaaaacaagtatctcaaaaa
attcttgattatagtaaccaggcaacagttagtactctggatctacatactgcacatgca
ttaccaccattttccattctggacaattctaacgaaactgctttcctgattggcattagt
gaagagtccgtggaaggcacagcagtttatctaccaggacctgacctctgcaaaacagac
ccatgcctcaacggaggcacctgttatcctacggagacttcctatgtgtgcacctgtgca
cctggctacagtggagaccagtgtgaactagattttgatgaatgtcactctaacccttgt
cggaatggtgccacctgtgtggatggttttaatacatttagatgtctctgcctcccaagt
tatgtcggggcactctgtgaacaagacactgagacatgtgactatggctggcacaaattc
caagggcagtgctacaagtactttgctcatcgacgcacatgggatgctgctgaaagggaa
tgtcgccttcagggtgcccacctcacaagcatcctttctcatgaggaacaaatgtttgtg
aatcgtgttggtcatgattaccagtggattggcctcaatgacaagatgtttgaacatgac
ttccgctggactgatggcagtgcactgcaatatgagaattggagacccaaccagccagac
agtttcttttctgcaggagaagactgcgttgtgatcatttggcacgagaatggtcagtgg
aatgatgtcccctgcaattaccacctcacctacacttgcaagaagggaacagttgcttgc
ggccaacccccagttgtagaaaatgccaagacctttggaaagatgaaaccacgttatgaa
atcaactccttgattagatatcactgcaaagatggtttcattcagcgtcaccttccaact
atccgttgcctaggaaatgggagatgggcaatgcctaaaataacctgcatgaacccatct
gcataccaaaggacttattctaagaaatacttaaaaaattcctcatcagcaaaggacaat
tctataaatacatcaaaacatgagcatcgctggagccggaggtggcaggaaacgaggcgc
tga

DBGET integrated database retrieval system