KEGG   Mus pahari (shrew mouse): 110328865
Entry
110328865         CDS       T05929                                 
Symbol
F2rl2
Name
(RefSeq) proteinase-activated receptor 3
  KO
K04235  coagulation factor II (thrombin) receptor-like 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04080  Neuroactive ligand-receptor interaction
mpah04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110328865 (F2rl2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110328865 (F2rl2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mpah04030]
    110328865 (F2rl2)
G protein-coupled receptors [BR:mpah04030]
 Rhodopsin family
  Peptide
   Thrombin
    110328865 (F2rl2)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 110328865
NCBI-ProteinID: XP_021064025
Ensembl: MGP_PahariEiJ_G0015878
LinkDB
Position
11:26811586..26816216
AA seq 370 aa
MKVLILVAAKLLFLQATVCQSGMKDVSDNAAKLTLTIKSFNGGPQNTFEEFPLSDIEGWT
GATTTVKARCSEESISTLHVNNATIGYLRSSLSTKVIPAIYILLFVVGVPANIVTLWKLA
SRTRSICLVIFHTNLAIADLLFCVTLPFKIAYHLNGNNWIFGEVMCRITTVVFYGNMYCA
ILILTCMGINRYLATAHPFTYQKLPKRGFSLLMCGVVWVMVFLCMLPFAILKQEYHLVQS
EIITCHDVVDMCESPSPFRFYYFVSLAFFGFLIPFVIIVFCYTTLIHKLNSKNRIWLGYI
KGVLLILVIFTICFAPTNIILIIHHANYYYHNTDSLYFMYLIALCLGSLNSCLDPFLYFV
MSKVVDQLNP
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgaaagtccttatcttggttgcggctaagctgctgtttctgcaggccaccgtttgccag
agtggcatgaaagatgtttcagacaatgcagcaaagctaaccttaactattaagagtttt
aatgggggtccccaaaatacctttgaagaattcccactttctgacatagagggctggaca
ggagccaccacaactgtaaaagcgaggtgctctgaggaaagtatttcaactctccatgtg
aataatgctaccataggctacctgagaagttccttaagtaccaaagtgatacctgctatc
tacatcctgctgtttgtggttggtgtaccagccaacatcgtgaccctgtggaaactcgcc
tcaaggaccagatccatctgtctggtcatctttcataccaacctagccatcgcggatctc
cttttctgtgtcacgctgccatttaagatcgcctaccatctcaatgggaacaactggata
tttggtgaggtcatgtgccggatcaccacggtcgttttctatggcaacatgtactgcgct
atcctgatcctcacctgcatgggcatcaaccgctacctggccacggctcaccctttcacg
taccagaagctgcccaagcgcggcttctccttgctcatgtgtggcgtggtgtgggtcatg
gttttcttatgtatgctgccctttgccattctgaagcaggagtaccacctcgtccagtca
gagatcatcacctgccacgatgtcgtcgacatgtgcgagtccccatcgcccttccgattc
tactacttcgtctccttagcattctttgggttcctcatcccgtttgtgatcatcgtcttc
tgctacacgactctcatccacaaacttaactcaaagaatcgtatatggctggggtacatc
aagggggtcctcctcatccttgtgattttcacaatttgctttgcccccaccaacatcata
ctcataatccaccatgccaactactactaccacaataccgacagcttgtactttatgtat
ctcatcgctctgtgcctggggagcctgaacagctgcctagatccattcctttattttgtc
atgtcgaaagttgtagatcagcttaatccttag

KEGG   Mus pahari (shrew mouse): 110337063
Entry
110337063         CDS       T05929                                 
Symbol
F2rl3
Name
(RefSeq) proteinase-activated receptor 4
  KO
K04236  coagulation factor II (thrombin) receptor-like 3
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04015  Rap1 signaling pathway
mpah04080  Neuroactive ligand-receptor interaction
mpah04610  Complement and coagulation cascades
mpah04611  Platelet activation
mpah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110337063 (F2rl3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110337063 (F2rl3)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110337063 (F2rl3)
   04611 Platelet activation
    110337063 (F2rl3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110337063 (F2rl3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mpah04030]
    110337063 (F2rl3)
G protein-coupled receptors [BR:mpah04030]
 Rhodopsin family
  Peptide
   Thrombin
    110337063 (F2rl3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srw 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 110337063
NCBI-ProteinID: XP_021075464
Ensembl: MGP_PahariEiJ_G0021692
LinkDB
Position
19:87422573..87424790
AA seq 396 aa
MCWPLLYPLVLGLSISLAEGNQTPSIYDDVESTRGSHEGPLGPTVELKESKSPDQPHPRG
FPGKFCANDSDTLELPASSQALLLGWVPTRLVPALYGLVVAVGLPANGLALWVLATRVPR
LPSTILLMNLAVADLLLALVLPPRLAYHLRGQRWPFGETACRVATAALYGHMYGSVLLLA
AVSLDRYLALVHPLRARALRGQRLTAGLCLVAWLSAATLALPLTLHRQTFRLAGSDRMLC
HDALPLAEQTSHWRRAFTCLAVLGCFVPLLAMGLCYGATLRALAANGQRYSHALRLTALV
LFSAVASFTPSNVLLVLHYSNPSPEAWGNLYGAYVPSLALSTLNSCVDPFIYYYVSHEFR
EKVRAMLCRQPEVSNSSQASREAGSRGTAVCSSTLL
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgtgctggccgctgctgtatcctttggtgctggggctcagcatcagcctggcagagggc
aaccagacccccagcatctacgatgatgtagagagtaccaggggaagccatgaaggccct
ctgggtcccacagtagaactcaaggaatcgaagtccccagaccagcctcatccacgaggc
ttcccgggcaagttctgtgccaacgacagtgatacgctggagctcccggccagctctcaa
gcactgctgctggggtgggtccccacgaggctggtacctgccctctatgggcttgtggtg
gccgtggggctgcctgccaatgggctggcgctgtgggtgctggccacaagggtgccacgc
ctgccatccaccattctgctcatgaacctggcagtggctgacctgcttttggccctggtg
ctgccaccacgactggcttaccacctgcgtggccagcgctggccgtttggggagactgcc
tgccgggtggccacagctgccctctatggccacatgtatggctcagtgttgctgttggct
gcagtcagcctggacagatacctggccctggtgcatcctttgcgggcccgtgcactgcgc
ggtcaacgcctcaccgctggactctgtttggtggcctggctctctgcagccaccctggcc
ttgcctctcactctgcatcggcagaccttccgattagctggctctgatcgcatgctgtgt
cacgatgcactgcccttggctgagcagacctcccactggagacgggcctttacctgcctg
gctgtcctgggctgcttcgtgccactgctggccatgggcctgtgctatggggccaccctt
cgtgcactggcggccaatggccagcgctacagccatgcactcagactgacagccctggta
ctgttctcggcagtggcctctttcacacctagcaatgtgctgctggtgctgcactattca
aacccaagccccgaggcctggggcaatctctatggagcctatgtgcccagcctggcactc
agcaccctcaacagctgtgtagaccctttcatctactactatgtgtcccacgagtttagg
gagaaggtacgggctatgttgtgtcgccagccggaggtcagcaactcctctcaggcctcc
agggaggctggaagccgagggactgccgtttgctcctctacgcttctgtga

DBGET integrated database retrieval system