KEGG   Mus pahari (shrew mouse): 110329314
Entry
110329314         CDS       T05929                                 

Gene name
Mgrn1
Definition
(RefSeq) E3 ubiquitin-protein ligase MGRN1 isoform X1
  KO
K10604  E3 ubiquitin-protein ligase MGRN1 [EC:2.3.2.27]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04120  Ubiquitin mediated proteolysis
mpah04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110329314 (Mgrn1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110329314 (Mgrn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110329314 (Mgrn1)
Enzymes [BR:mpah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     110329314 (Mgrn1)
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    110329314 (Mgrn1)
SSDB
Motif
Pfam: zf-C3HC4_3 Prok-RING_4 zf-RING_2 zf-RING_5 zf-C3HC4_2
Other DBs
NCBI-GeneID: 110329314
NCBI-ProteinID: XP_021064527
Ensembl: MGP_PahariEiJ_G0016120
LinkDB
Position
12
AA seq 578 aa
MGSILSRRIAGVEDIDIQANSAYRYPPKSGNYFASHFFMGGEKFDTPHPEGYLFGENMDL
NFLGSRPVQFPYVTPAPHEPVKTLRSLVNIRKDSLRLVRYKDDADSPTEDGEKPRVLYSL
EFTFDADARVAITIYCQAVEELVNGMAVYSCKNPSLQSETVHYKRGVSQQFSLPSFKIDF
SEWKDDELNFDLDRGVFPVVIQAVVDEGDVVEVTGHAHVLLAAFEKHVDGSFSVKPLKQK
QIVDRVSYLLQEIYGIENKNNQETKPSDDENSDNSSECVVCLSDLRDTLILPCRHLCLCT
SCADTLRYQANNCPICRLPFRALLQIRAVRKKPGALSPISFSPVLAQSVDHDEHSCPFKK
SKSHPASLASKKPKRETSSDSIPPGYEPISLLEALNGLRAASPAIPSAPLYEEITYSGIS
DGLSQASCPLAGLDRIMESGLQKGKTQSKSPDSTLRSPSSPIHEEDEEKFSEDLDAPLPP
SGVELVLRESSSPESFGTEVVDEPSLKQGTRVPSIDDVLQDGSPQHHGGSQPVPPADIYL
PGWSTSMEPPHSLGTTSSPWPLLSGSSPEPGAAELTPF
NT seq 1737 nt   +upstreamnt  +downstreamnt
atgggctccatcctgagtcgccgcatcgcgggcgtggaggacatcgacattcaggccaac
tcggcctatcgctaccctccgaagtccggaaactactttgcttcgcattttttcatggga
ggagagaaatttgacactccccatcctgaaggttacctctttggagagaacatggatctg
aacttcctgggcagtcgtccagtccagtttccctatgtcacccctgccccccatgagcca
gtgaagacactgaggagcctggtaaacattcgcaaagactctctccggcttgtgaggtac
aaagatgacgcagacagccccacggaggacggtgagaagccccgggtgctctacagtctg
gaattcacctttgatgccgatgcccgtgtggctatcaccatttattgtcaggcagtggag
gagctggtgaacggcatggcagtgtacagctgtaagaacccttctctgcaatctgagacc
gtccactacaagagaggcgttagccagcagttctccctgccttctttcaagattgacttc
tctgagtggaaggatgatgagctgaactttgacctggaccgaggtgtgtttccagtagtc
atccaggctgtggtggatgaaggggatgttgtggaagtgactggccacgctcacgtgctc
ctggctgcctttgagaagcatgtggatggcagcttctccgtgaagccattaaagcagaag
caaattgtggaccgggtcagctacctgctgcaggagatctacggcatcgagaacaagaac
aaccaggagactaagccttctgatgatgagaacagtgacaatagcagtgagtgtgtggtg
tgcctatcagacctgcgggacacgctgatcctgccctgccgccacctgtgcctctgcact
tcctgtgctgatacactgcggtaccaggccaacaactgccccatctgccggctgccgttc
cgagccctcctgcagatccgggctgtgcggaagaagccaggggccctgtctcccatctcc
ttcagccctgtcttggcccaaagtgtggatcacgatgagcactcttgtccctttaaaaaa
tcaaagtcgcaccctgcctccctggccagcaagaaacctaaaagggaaacaagttctgac
agtatcccacctggctatgaacccatctccttgcttgaggcactcaatggtctacgggct
gcctccccggctattccatcagctcccctctatgaggaaatcacctactcaggcatatcg
gatggtctttcccaggccagttgtccccttgctggacttgatcgaatcatggaaagtggc
ctacagaagggcaagacacagagcaagtctccagacagcaccctgcggtctccatcatcc
cccatccatgaggaggatgaggagaagttctcagaggacttggatgctcctctcccacca
agcggtgtggagctggtgctgcgggagagcagctcccctgagagtttcggaacagaggtg
gtggatgagccatccctaaagcaagggacccgagtaccctcgattgatgatgtcctgcaa
gatggcagtccgcagcatcatggtggcagccagccagtccctcctgctgacatctaccta
ccaggatggtccacctccatggagccgccacacagccttggcaccaccagctccccctgg
cctctgctgagtggctctagtcctgagcctggagctgctgagctgaccccattctga

DBGET integrated database retrieval system