KEGG   Mus pahari (shrew mouse): 110329549
Entry
110329549         CDS       T05929                                 
Symbol
Alcam
Name
(RefSeq) CD166 antigen isoform X1
  KO
K06547  activated leukocyte cell adhesion molecule
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110329549 (Alcam)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mpah04515]
    110329549 (Alcam)
   04090 CD molecules [BR:mpah04090]
    110329549 (Alcam)
Cell adhesion molecules [BR:mpah04515]
 Immunoglobulin superfamily
  ALCAM
   110329549 (Alcam)
CD molecules [BR:mpah04090]
 Proteins
  110329549 (Alcam)
SSDB
Motif
Pfam: Ig_3 C2-set_2 Ig_2 I-set ig C1-set V-set CD34_antigen DUF6377 Amnionless FixQ Podoplanin Syndecan
Other DBs
NCBI-GeneID: 110329549
NCBI-ProteinID: XP_021064874
Ensembl: MGP_PahariEiJ_G0016502
LinkDB
Position
12:complement(46251137..46446385)
AA seq 583 aa
MASKVSPSCRLVFCLLISAAVLRPGLGWYTVNSAYGDTIVMPCRLDVPQNLMFGKWKYEK
PDGSPVFIAFRSSTKKSVQYDDVPEYKDRLSLSENYTLSIANAKISDEKRFVCMLVTEDN
VFEAPTLVKVFKQPSKPEIVNKAPFLETDQLKKLGDCISRDSYPDGNITWYRNGKVLQPM
EGEVAILFKKEIDPGTQLYTVTSSLEYKTTRSDIQMPFTCSVTYYGPSGQKTIYSEQEIF
DIYYPTEQVTIQVLPPKTAIKEGDNITLQCLGNGNPPPEEFMFYLPGQPEGIRSSNTYTL
TDVRRNATGDYKCSLIDKRNMAASTTITVHYLDLSLNPSGEVTKQIGDTLPVSCTISASR
NATVVWMKDNIRLRSSPSFSSLHYQDAGNYVCETALQEVEGLKKRESLTLIVEGKPQIKM
TKKTDPSGLSKTIICHVEGFPKPAIQWTITGSGSVINQTEESPYINGRYYSKIIISPEEN
VTLTCAAENQLERTVNSLNVSAISIPEHDETDNISDENREKVNDQAKLIVGIVVGLLLAA
LVAGVVYWLYMKKSKTASKHVNKDLGNMEENKKLEENNHKTEA
NT seq 1752 nt   +upstreamnt  +downstreamnt
atggcatctaaggtgtccccttcttgccgtctggttttctgcctcttgatctccgccgcg
gtcctcagaccaggccttggatggtacactgtcaactcagcatatggagacaccatcgtc
atgccttgccgtctcgacgtacctcagaacctcatgtttggcaaatggaaatatgaaaag
cccgatgggtccccagtatttattgcattcagatcttctacgaagaaaagtgtgcaatat
gatgatgtcccagagtacaaggacagactgagcctctcagaaaactacactttgtctatc
gccaatgctaagatcagtgatgagaagagatttgtgtgcatgttagtgaccgaggacaac
gtgtttgaagcaccgaccctagtcaaggtgttcaagcaaccatctaaacctgaaattgta
aacaaagcaccctttcttgaaacagatcagctgaaaaagttaggtgactgcatttcaaga
gacagttacccagacggcaacatcacgtggtacaggaatggcaaagtgctgcaacccatg
gaaggagaggtggccatactttttaaaaaggaaattgatccaggaactcagttgtatacc
gtgacttcctccttggagtacaagacaaccaggtctgacatacaaatgccattcacctgt
tctgtgacatattatggaccctctggccagaaaacaatttattctgaacaagaaatcttt
gatatttactatcctacagagcaggtgacaatacaagtgctgccaccaaaaactgccatc
aaagaaggggacaacatcacccttcagtgtttggggaatggcaacccacctcctgaggag
ttcatgttttacttaccaggacagcctgaaggcataagaagctcaaacacttacacactg
acagatgtgagacgcaatgccacaggggactacaaatgctcactgattgacaaaagaaac
atggccgcttcaacgaccatcacagttcactacttggatttatccttaaacccaagtgga
gaagtgaccaagcagattggtgataccctgcctgtgtcatgcacaatatctgcaagtagg
aacgcgactgtggtgtggatgaaggataacatccggctccgatccagcccttcattttcc
agtcttcattatcaggatgctgggaactacgtctgtgaaactgctcttcaggaggttgag
ggactgaagaaaagggagtcgctgactctcattgtagaagggaaacctcagatcaaaatg
acaaagaaaactgatcccagtggactgtctaaaactataatctgccacgtggaagggttt
ccaaagccagctatacagtggaccataactggcagtgggagcgtcataaaccaaacagag
gagtctccttatattaatggcaggtattatagtaaaattatcatttcccctgaggagaat
gttacattaacttgcgcagcagaaaaccaactggagagaacagtaaactccctgaatgtc
tctgcgataagtattccagagcacgatgagacagacaatataagtgatgaaaacagagaa
aaggtgaatgaccaggcaaaactgattgtgggaattgtcgtcggtctcctcctcgctgcc
cttgttgctggcgttgtctactggctgtacatgaagaagtccaaaactgcatcaaaacat
gtaaacaaggaccttggtaatatggaggagaataaaaagctggaagaaaataatcacaaa
acagaagcctaa

DBGET integrated database retrieval system