KEGG   Mus pahari (shrew mouse): 110329586
Entry
110329586         CDS       T05929                                 

Gene name
Crkl
Definition
(RefSeq) crk-like protein isoform X1
  KO
K04438  C-crk adapter molecule crk
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04015  Rap1 signaling pathway
mpah04062  Chemokine signaling pathway
mpah04510  Focal adhesion
mpah04666  Fc gamma R-mediated phagocytosis
mpah04722  Neurotrophin signaling pathway
mpah04810  Regulation of actin cytoskeleton
mpah04910  Insulin signaling pathway
mpah04935  Growth hormone synthesis, secretion and action
mpah05100  Bacterial invasion of epithelial cells
mpah05135  Yersinia infection
mpah05163  Human cytomegalovirus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
mpah05206  MicroRNAs in cancer
mpah05211  Renal cell carcinoma
mpah05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110329586 (Crkl)
   04012 ErbB signaling pathway
    110329586 (Crkl)
   04015 Rap1 signaling pathway
    110329586 (Crkl)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110329586 (Crkl)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110329586 (Crkl)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    110329586 (Crkl)
   04062 Chemokine signaling pathway
    110329586 (Crkl)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110329586 (Crkl)
   04935 Growth hormone synthesis, secretion and action
    110329586 (Crkl)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110329586 (Crkl)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110329586 (Crkl)
   05206 MicroRNAs in cancer
    110329586 (Crkl)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    110329586 (Crkl)
   05211 Renal cell carcinoma
    110329586 (Crkl)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110329586 (Crkl)
   05163 Human cytomegalovirus infection
    110329586 (Crkl)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110329586 (Crkl)
   05100 Bacterial invasion of epithelial cells
    110329586 (Crkl)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 hSH3
Other DBs
NCBI-GeneID: 110329586
NCBI-ProteinID: XP_021064954
Ensembl: MGP_PahariEiJ_G0016220
LinkDB
Position
12
AA seq 303 aa
MSSARFDSSDRSAWYMGPVTRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSH
YIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPVGSISAPNLPT
AEENLEYVRTLYDFPGNDAEDLPFKKGELLVIIEKPEEQWWSARNKDGRVGMIPVPYVEK
LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPTVASTPGAAINPLPSTQNGPVFA
KAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPD
DNE
NT seq 912 nt   +upstreamnt  +downstreamnt
atgtcctccgccaggtttgattcttcagaccgctctgcctggtacatggggccggtgact
cgccaggaggcgcagactcgtctccagggccagcgccatggcatgttcctagtccgggac
tcatctacctgccccggggactatgtactgtccgtgtccgagaactcgcgtgtctcgcac
tacatcatcaactccctgcccaaccgccgctttaagatcggggaccaggagtttgaccat
ttgccggccttgctggagttctacaagatccactacctggacactaccaccttaatcgaa
ccggcgcccaggtacccaagcccaccagtgggttctatctcagcacccaacttacctaca
gcagaagaaaatctggaatatgtacggactctgtatgattttcctgggaatgatgctgaa
gacctaccctttaagaagggtgagcttctagtgataatagaaaagcctgaagagcagtgg
tggagtgcccgcaacaaggacggccgggttgggatgattcctgtcccttacgttgaaaag
cttgtgaggtcttcgccacatggaaagcatggaaataggaattctaacagttacggcatc
ccagaacctgctcacgcgtatgctcaacctcagaccacaactcctctacctacagttgcc
agtactcctggggcagcaatcaaccctttgccatccacacagaatggacctgtctttgca
aaagcaatccagaagagagtaccttgtgcttatgacaagactgccttggcattggaggtt
ggtgacattgtgaaagtcacaaggatgaatatcaatggccaatgggaaggcgaggtgaat
gggcgcaaggggcttttccccttcacacatgtcaaaatctttgaccctcagaaccccgat
gacaacgagtga

KEGG   Mus pahari (shrew mouse): 110331717
Entry
110331717         CDS       T05929                                 

Gene name
Crk
Definition
(RefSeq) adapter molecule crk isoform X1
  KO
K04438  C-crk adapter molecule crk
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04015  Rap1 signaling pathway
mpah04062  Chemokine signaling pathway
mpah04510  Focal adhesion
mpah04666  Fc gamma R-mediated phagocytosis
mpah04722  Neurotrophin signaling pathway
mpah04810  Regulation of actin cytoskeleton
mpah04910  Insulin signaling pathway
mpah04935  Growth hormone synthesis, secretion and action
mpah05100  Bacterial invasion of epithelial cells
mpah05135  Yersinia infection
mpah05163  Human cytomegalovirus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
mpah05206  MicroRNAs in cancer
mpah05211  Renal cell carcinoma
mpah05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110331717 (Crk)
   04012 ErbB signaling pathway
    110331717 (Crk)
   04015 Rap1 signaling pathway
    110331717 (Crk)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110331717 (Crk)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110331717 (Crk)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    110331717 (Crk)
   04062 Chemokine signaling pathway
    110331717 (Crk)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110331717 (Crk)
   04935 Growth hormone synthesis, secretion and action
    110331717 (Crk)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110331717 (Crk)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110331717 (Crk)
   05206 MicroRNAs in cancer
    110331717 (Crk)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    110331717 (Crk)
   05211 Renal cell carcinoma
    110331717 (Crk)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110331717 (Crk)
   05163 Human cytomegalovirus infection
    110331717 (Crk)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110331717 (Crk)
   05100 Bacterial invasion of epithelial cells
    110331717 (Crk)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 SH3_10 DUF3804
Other DBs
NCBI-GeneID: 110331717
NCBI-ProteinID: XP_021068203
Ensembl: MGP_PahariEiJ_G0017884
LinkDB
Position
14
AA seq 304 aa
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHY
IINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSR
SKQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRG
MIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA
RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPD
EDFS
NT seq 915 nt   +upstreamnt  +downstreamnt
atggcgggcaacttcgactcggaggagcggagtagctggtactggggccgcttgagccgg
caggaggcggtggcgctattgcagggccagcggcacggggtgttcctggtgcgggactcg
agcaccagccccggggactatgtgcttagcgtctccgaaaactcgcgcgtctcccactac
atcatcaacagcagtggcccgcgccctccagtgcctccgtcgcccgctcagcctccgccg
ggagtgagtccctccaggctccgaataggagatcaagaatttgattcattgcctgcttta
ctggaattctacaaaatacactatttggacactacaacattgatagaaccagtttccaga
tcaaagcagggtagtggagtgattctcaggcaggaggaggcagagtatgtgcgggccctc
tttgactttaatgggaatgatgaagaagatcttccctttaagaaaggagacatcctgaga
atccgggataagcctgaagagcagtggtggaatgcagaggacagcgaaggaaagaggggg
atgattcctgtcccttacgtggagaagtatagacctgcctccgcctcagtatcggctctg
attggaggtaaccaggagggttcccacccacagccactgggtgggccggagcctgggccc
tatgcccaacccagcgtcaacactccgctccctaacctccagaatgggcccatttatgcc
agggttatccagaagcgagtccctaatgcctacgacaagacagccttggctttggaggtc
ggtgagctggtaaaggttacgaagattaatgtgagtggtcagtgggaaggggagtgtaat
ggcaaacgaggtcacttcccattcacacatgtccgtctgctggatcaacagaatcccgat
gaggacttcagctga

DBGET integrated database retrieval system