KEGG   Mus pahari (shrew mouse): 110329687
Entry
110329687         CDS       T05929                                 
Symbol
Cd22
Name
(RefSeq) B-cell receptor CD22
  KO
K06467  CD22 antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04640  Hematopoietic cell lineage
mpah04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110329687 (Cd22)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110329687 (Cd22)
   04662 B cell receptor signaling pathway
    110329687 (Cd22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110329687 (Cd22)
   04091 Lectins [BR:mpah04091]
    110329687 (Cd22)
CD molecules [BR:mpah04090]
 Proteins
  110329687 (Cd22)
Lectins [BR:mpah04091]
 I-type lectins (Siglecs)
  110329687 (Cd22)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig I-set V-set Ig_4 C1-set C2-set_2 Ig_5 Ig_6 Adeno_E3_CR1 Baculo_E56 CARDB
Other DBs
NCBI-GeneID: 110329687
NCBI-ProteinID: XP_021065137
Ensembl: MGP_PahariEiJ_G0012783
LinkDB
Position
1:complement(3796532..3808249)
AA seq 863 aa
MHVHCPWLLLILGHAASTPHTSANEWTVDRPQTLFAWEGACIWIPCKYKTPLPKARLENI
LLFQNYEFDKATKEFKGTVLYNATKPEKSPEPELYLSKQGRVTFLGNRISNCTLKIHPIR
ANDSGELGLRMTAGTERWMEHIHLNVSEKPLQPYIQMPSEIRESQSVTLTCGLNFTCFGY
DIHLQWFLGDSEVTSATSSVTSSVKNVYTESKFTFQPNWKHHGKSVTCQVQHSSKVLSES
TVRLDVKYTPKLEIKVNPTEVEEENSVTMTCQVNNSNPKISTVAVSWFKDGRLLEDREQE
QEQEQQMSKLTLHSVTKDMSGRYHCQASNDIGPGRSEEVELTVHYAPEPSRVHIYPSPAE
EGQSVELVCESLASPSATSYTWYHNRKHVPGDTQEKLRIPQVSLWHAGNYSCLAENRLGR
GQIDQEAKLDVHYAPKAVTTVIRSSTPIREGDSVTLVCRYNSSNPEVTSYKWSPQGSGSE
LKPGVLRIQKVTWDSMPVSCAACNYKCSWASPVSLNVHYAPRAVKVLKVSPASEIRAGQR
VLLQCDFSGSHPAEVRFFWKKNGSLVQEGRDLSFSSISPEDSGNYNCMVNNSIGETLSQA
WSLQVLYAPRRLRVSISPGDRVMEGKKATLSCESDANPPIFQYTWFDSSGQDLHSSGQKL
RLEPLQVQHTGSYRCQGTNGIGTGDSPPSTLTVYYSPETIGKRVALGLGICLAICTLAIW
GMKIQKKWKQNRSQQGLQENSSGQSFFVRNKKARRTPLSEGPQSQGCYNPAMDDTISYAI
LHFPESDTRSAGDAGTPATQGPPPKNSNSVTYSVLQMRPMDDYENVNPSCPEDDSIHYSE
LVQFGDGKRPQAKEDVDYVTLKH
NT seq 2592 nt   +upstreamnt  +downstreamnt
atgcacgtccactgcccgtggctcctcctgattctaggacacgcggcttcgactccgcac
acctcagcaaatgaatggactgttgaccgtccccaaaccctcttcgcctgggagggagcc
tgcatctggattccttgcaagtacaaaactccactacccaaggcacgtttggaaaacatc
ctcctttttcagaactatgagtttgacaaggccaccaaggaattcaaaggaactgtcctg
tacaacgccacaaagcctgagaagagcccagagcctgagctgtacctttctaagcaaggg
agagtaacatttctggggaacagaataagcaattgtaccctgaaaatccacccgatacgt
gccaatgacagtggggagctggggttgaggatgaccgcagggactgaacgatggatggag
cacattcacctcaatgtttccgagaaaccgcttcaaccttacatccagatgccatcagaa
atccgggaatcccaaagtgtcactctgacctgtggactgaatttcacctgctttgggtat
gacatccacttgcagtggttcctgggagattctgaggtcacctccgccacctcttctgtc
acctcctccgttaagaatgtctatacagagagcaagttcaccttccaaccaaactggaag
caccatggaaagagcgtgacgtgccaagtccagcactcctccaaagtgctctctgagagc
actgtgcgtctggatgttaagtataccccgaagctggagatcaaggtcaatcccacagag
gtggaagaggagaactctgtgaccatgacatgccaggtgaacaacagcaacccgaaaatc
agtacggtggcggtgtcttggttcaaggatgggcgcctcctagaggatcgggaacaggaa
caggaacaggaacaacagatgtccaagctaactctgcactcggtgaccaaggacatgagc
ggcagataccattgccaggcttccaacgacataggcccaggacggtcggaagaagtggaa
ctcaccgtgcactatgctccagagccctcccgggttcacatctacccttcccccgctgaa
gagggacagtcagtagagctggtttgtgagtcactggccagtccgagtgcaacaagctac
acctggtatcacaacaggaaacacgtacctggagacacccaagagaagcttcggatccct
caggtctccctgtggcatgctgggaattactcttgcttggcagagaaccgtctgggtcgt
ggacagatagaccaggaagctaagctggatgtccattatgctcccaaggctgtgaccaca
gtgattcggagctccacaccaattcgggaaggagacagtgtgaccctggtctgtaggtac
aactccagcaatccagaggtcacctcctacaaatggagcccccaaggttctgggagtgaa
ctcaaacccggagtgctgaggattcagaaagtgacatgggattccatgcctgtcagctgt
gctgcctgcaactacaagtgttcgtgggcctcccctgtcagcctgaatgtccactacgct
cccagagctgtgaaggtactgaaggtaagccccgcatcagagatccgcgctgggcagcgt
gtcctcctccaatgcgacttctcagggagccacccagcagaggtccgcttcttctggaag
aagaatgggagtcttgtgcaggaagggagagacctgagcttcagctccatctctccagaa
gattctggaaactataactgcatggtcaacaactccatcggagagaccttgtcacaggcc
tggagcctccaagtgctgtacgctcctcggaggctgcgtgtatccatcagccctggggac
cgtgtgatggaggggaagaaggccaccttgtcctgtgagagtgatgccaacccgcccatc
tttcagtacacctggtttgactccagtggccaagacctccactcctcaggccagaaactg
agactggaacccctacaggtccaacacacgggttcctaccgctgccaagggaccaatggg
ataggcacaggagattcaccgcccagcaccctcactgtctactacagtccagagaccatc
ggcaagcgggtcgccttgggactagggatctgcctggctatctgcaccttggccatctgg
gggatgaaaatccagaaaaagtggaagcaaaaccgcagccagcaggggcttcaggaaaat
tccagtggccagagctttttcgtgaggaacaaaaaggctagaaggacccctctttcagaa
ggcccccaatcccagggatgctacaatccggcgatggatgacaccattagttatgccatc
ttgcactttccagagagtgacacacgcagcgctggagatgcggggaccccagcaacacag
ggtcctcctccaaagaacagcaactcggtcacttactcggtgctacagatgcggcctatg
gacgattatgagaatgtgaatccgagctgcccagaggatgacagcatccattactcagag
ctggttcagtttggggatggtaagcggccccaggcgaaggaagacgtagactatgtgacc
ctcaagcactga

DBGET integrated database retrieval system