KEGG   Mus pahari (shrew mouse): 110329814
Entry
110329814         CDS       T05929                                 
Symbol
Pros1
Name
(RefSeq) vitamin K-dependent protein S
  KO
K03908  protein S
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110329814 (Pros1)
SSDB
Motif
Pfam: Laminin_G_1 EGF_CA Laminin_G_2 Gla FXa_inhibition cEGF EGF EGF_3
Other DBs
NCBI-GeneID: 110329814
NCBI-ProteinID: XP_021065356
Ensembl: MGP_PahariEiJ_G0016563
LinkDB
Position
12:55732961..55799645
AA seq 675 aa
MRVLSARFRVLLACLALVIPVSETNFLSKEHASQVLVRRRRANTLFEETMKGNLERECIE
ELCNKEEAREVFENNPETDYFYPKYLGCLGAFRAGSFHAARQSVKAYPDLRSCVNAISDQ
CDPMPCNEDGYLSCKDGLAAFTCFCKPGWQGDRCQFDVNECKDPSNVNGGCSQVCDNTPG
SYHCSCKSGFAMLANKKDCKDLDECAVKPSVCGTAVCKNIPGDFECECPDGYRYDPSSKS
CKDVDECSENMCAQLCVNFPGGYSCYCDGKKGFKLAQDQKSCEGIPVCLSLDLDKNYELL
YLAEQFAGVVLYLKFRLPDITRFSAEFDFRTYDSEGIILYAESLDHANWLLIALRDGKIE
VQFKNEFSTQITTGGNVINNGIWNMVSVEELDDSVSIKIAKEAVMNINKLGSLFRPTDGF
LDTKIYFAGLPRKVESALIKPINPRLDGCIRGWNLMKQGALGAKEIIEGKQNKHCFLTVE
KGSYYPGSGIAQFSIDYNNVTNAEGWQMNVTLTIRPSTDTGVMLALVSGSTVPFALSLVD
SGSGTSQDIVVFVENSVAARLEDISLCSDQQSQLKCNVNRNGLELWTPLRKDVVYSKDLQ
RLLAILDKAMKRTVVTYLGGIPDISFSATPVNAFYSGCMEVNVNGVELDLDEAISKHNDI
RAHSCPSVRKIQKNF
NT seq 2028 nt   +upstreamnt  +downstreamnt
atgagggtcctgagcgcgcgctttcgggtgctactggcctgcctcgccctggtgatccct
gtctcagagacaaacttcttgtccaaagaacatgcttcacaagtcctggtgaggaggcgc
cgtgcaaataccttgtttgaagaaactatgaagggcaaccttgaacgagagtgcattgaa
gaactctgcaataaggaggaagccagggaggtctttgaaaataatcccgagacggattat
ttttatccaaaatatttaggttgtctgggggcattccgtgccggctcattccatgctgcg
aggcagtcagttaaggcttaccctgacctcagaagctgtgtcaatgccatctcagaccaa
tgtgaccctatgccatgcaatgaagatgggtatctgagctgcaaagatggcctagctgct
tttacttgcttctgtaagccaggctggcaaggagacaggtgtcagtttgatgtaaatgaa
tgtaaagatccctcgaatgtgaatggaggctgcagccaggtttgtgacaacactcctggg
agttaccactgctcctgtaaaagtggctttgctatgctggcaaataagaaagactgcaaa
gatttggatgaatgcgctgtaaagccgagtgtctgtggcacagccgtgtgcaagaacatt
ccaggcgacttcgaatgtgaatgtcccgacggctaccgatatgatccctcgtcaaaatct
tgtaaagatgtcgacgaatgctctgagaacatgtgtgctcaattgtgcgtcaattttcct
ggaggctactcttgttactgtgatgggaagaaaggattcaaacttgcccaagatcagaag
agttgtgagggtattccagtgtgcctttccttggaccttgacaaaaattatgaattatta
tacttggccgagcagtttgcaggggttgtcttatatctgaaatttcgattgccagatatc
accaggttttcagctgaatttgattttcggacgtacgattcagagggcatcatactgtat
gcagaatctctcgatcacgcaaattggctcctgattgcgcttcgtgatgggaagattgaa
gttcagtttaagaatgagttttcgacccaaatcacaactggaggcaatgttattaacaat
ggcatatggaatatggtgtctgtggaagaattagacgacagtgttagcattaaaatagct
aaggaggctgtgatgaatataaataaacttgggagcctttttaggcctaccgatggattt
ctggacaccaaaatatacttcgcaggcttacctcggaaggtggaaagcgcactcattaaa
ccgattaatccgcgactggatggatgtataagaggctggaatttgatgaaacaaggagct
ttaggtgccaaggaaataatcgaaggaaaacaaaataagcactgcttcctcactgtggag
aagggctcctactaccctggttcgggaattgctcagttcagcatagactacaataatgtg
actaatgcagagggttggcaaatgaatgtgaccttgactattcgcccctccactgacact
ggagtcatgcttgctttggtttctgggagcacagtgccctttgccttgtccttggtggat
tctggctccggaacttctcaggatattgtggtatttgttgaaaattcagtggcggctcga
ttggaagacatatctctgtgctcggatcagcaatcccaactgaaatgtaatgttaacaga
aatggactggaactgtggaccccacttagaaaagatgtcgtttattctaaagatcttcaa
aggctactcgccatcttggataaagcaatgaaaagaaccgtggtcacctacctgggtggc
atcccagatatttccttcagtgccacaccagtgaacgctttttacagcggctgcatggaa
gtgaatgtcaatggtgttgagttggatctggatgaagccatttctaaacacaacgacatt
cgagctcactcgtgcccatcagtgaggaaaatccagaagaacttctag

DBGET integrated database retrieval system