KEGG   Mus pahari (shrew mouse): 110329945
Entry
110329945         CDS       T05929                                 
Symbol
Cd80
Name
(RefSeq) T-lymphocyte activation antigen CD80
  KO
K05412  CD80 antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04620  Toll-like receptor signaling pathway
mpah04672  Intestinal immune network for IgA production
mpah04940  Type I diabetes mellitus
mpah05320  Autoimmune thyroid disease
mpah05322  Systemic lupus erythematosus
mpah05323  Rheumatoid arthritis
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110329945 (Cd80)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110329945 (Cd80)
   04672 Intestinal immune network for IgA production
    110329945 (Cd80)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    110329945 (Cd80)
   05323 Rheumatoid arthritis
    110329945 (Cd80)
   05320 Autoimmune thyroid disease
    110329945 (Cd80)
   05330 Allograft rejection
    110329945 (Cd80)
   05332 Graft-versus-host disease
    110329945 (Cd80)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110329945 (Cd80)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110329945 (Cd80)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110329945 (Cd80)
CD molecules [BR:mpah04090]
 Proteins
  110329945 (Cd80)
SSDB
Motif
Pfam: C2-set_2 Ig_3 ig V-set C1-set Ig_2 I-set Izumo-Ig MLANA
Other DBs
NCBI-GeneID: 110329945
NCBI-ProteinID: XP_021065554
Ensembl: MGP_PahariEiJ_G0016444
LinkDB
Position
12:33443840..33469112
AA seq 306 aa
MARSGQLMQETPLLKFPCLRLVHLFVPLLCLSRVSSGVDEQVSKSVKDKALLPCHYNSPH
EDQSKDRIYWQKHDKVVLSVIAGELKVWPEYKNRTLYDNTTHSLIILGLVLSDRGTYNCV
VQKKERGIYEVKHLASVKLSVKADFPTPNITESGNPSADTKTITCFASGGFPKPRLSWME
NGRELPGINTTISQDPESELYTVSSQLDFNVTYNHTIKCSIEYGDALVSENFTWKKPPED
PPDRENTIALFGAGFGAVITVVAVVVVIIKCFCKHRSCFRRRNEASREMNNSLNFGPAEA
SAEQTV
NT seq 921 nt   +upstreamnt  +downstreamnt
atggctcgcagtggtcagctgatgcaggagacaccactcctcaagtttccgtgtctcagg
ctcgttcatctctttgtgccgctgctttgtctttcacgggtgtcttcaggtgttgatgaa
caagtatccaagtcagtgaaagataaggcattgctgccttgtcattacaactctcctcat
gaagatcagtccaaagaccgaatctactggcaaaaacatgacaaagtggtgctgtctgtc
atcgctggggaactaaaagtatggcccgagtataagaaccggactttatatgacaacact
acccactctcttatcatcctgggcctggtcctttcagacaggggcacatacaactgtgtc
gttcaaaagaaggaaagaggaatttatgaagttaaacacttggcttccgtgaagctgtct
gtcaaagctgacttccctacccccaacataactgagtctggaaacccatctgcagacact
aaaacgattacctgctttgcttccgggggtttcccaaagcctcgcctctcttggatggaa
aatggaagagaattacctggcatcaatacaacaatttcccaggatcctgaatctgaactg
tacaccgttagtagccaactagatttcaatgtgacatacaaccacaccattaagtgttcc
attgaatacggagacgctctcgtgtcagagaacttcacctggaaaaaacccccagaagac
cctcctgatagagagaacacaattgcgctctttggggcaggattcggtgcagtaataaca
gttgtcgccgttgtcgttgtcatcatcaaatgcttctgtaaacacagaagctgtttcaga
agaagaaatgaggcaagcagagaaatgaacaacagcctcaacttcgggcctgcagaagca
tcagccgaacagactgtctga

DBGET integrated database retrieval system