KEGG   Mus pahari (shrew mouse): 110330068
Entry
110330068         CDS       T05929                                 
Symbol
Mrap
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04927  Cortisol synthesis and secretion
mpah04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    110330068 (Mrap)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110330068 (Mrap)
SSDB
Motif
Pfam: MRAP
Other DBs
NCBI-GeneID: 110330068
NCBI-ProteinID: XP_021065672
Ensembl: MGP_PahariEiJ_G0016652
LinkDB
Position
12:81807879..81818757
AA seq 127 aa
MANRTNASVPFTSYEYYLDYIDLIPVDEKKLKANKHSILIALWLSLATFVVLLFLILLYM
SWSGSPQLRHSPQPQPLCPWTHGFNLPLCLRRASLQTTEEPGRRAGTDQWLTQQSPSVSA
PGPLALP
NT seq 384 nt   +upstreamnt  +downstreamnt
atggccaacaggaccaacgcctctgtcccattcaccagctatgagtattacctggactac
atagacctcattccagtggacgagaagaagctgaaggccaacaagcattccatcctcatt
gccttgtggttgagcctggctaccttcgtggtgctcctcttcctcattctgctctacatg
tcctggtcaggctccccacagttgaggcacagtccccaacctcagccactatgtccatgg
actcacggcttcaacctccccctgtgcctccggagggcctccctgcagacaacggaggag
ccaggaaggagagctggcactgaccagtggttaacgcagcagagtccttccgtctcagcc
ccggggcccctggctctcccctag

DBGET integrated database retrieval system