KEGG   Mus pahari (shrew mouse): 110331264
Entry
110331264         CDS       T05929                                 

Gene name
Smurf2
Definition
(RefSeq) E3 ubiquitin-protein ligase SMURF2
  KO
K04678  E3 ubiquitin ligase SMURF1/2 [EC:2.3.2.26]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04120  Ubiquitin mediated proteolysis
mpah04144  Endocytosis
mpah04340  Hedgehog signaling pathway
mpah04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110331264 (Smurf2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110331264 (Smurf2)
   04350 TGF-beta signaling pathway
    110331264 (Smurf2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110331264 (Smurf2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110331264 (Smurf2)
   04121 Ubiquitin system [BR:mpah04121]
    110331264 (Smurf2)
   03029 Mitochondrial biogenesis [BR:mpah03029]
    110331264 (Smurf2)
Enzymes [BR:mpah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     110331264 (Smurf2)
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    110331264 (Smurf2)
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    110331264 (Smurf2)
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  HECT type E3
   110331264 (Smurf2)
Mitochondrial biogenesis [BR:mpah03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    110331264 (Smurf2)
SSDB
Motif
Pfam: HECT WW C2 HPS3_N
Other DBs
NCBI-GeneID: 110331264
NCBI-ProteinID: XP_021067394
Ensembl: MGP_PahariEiJ_G0018461
LinkDB
Position
14
AA seq 748 aa
MSNPGGRRNGPVKLRLTVLCAKNLVKKDFFRLPDPFAKVVVDGSGQCHSTDTVKNTLDPK
WNQHYDLYIGKSDSVTISVWNHKKIHKKQGAGFLGCVRLLSNAINRLKDTGYQRLDLCKL
GPNDNDTVRGQIVVSLQSRDRIGTGGQVVDCSRLFDNDLPDGWEERRTASGRIQYLNHIT
RTTQWERPTRPASEYSSPGRPLSCFVDENTPITGTNGATCGQSSDPRLAERRVRSQRHRN
YMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSNINCEELGPLP
PGWEIRNTATGRVYFVDHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQQVVSLCPDDT
ECLTVPRYKRDLVQKLKILRQELSQQQPQAGHCRVEVSREEIFEESYRQVMKMRPKDLWK
RLMIKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHL
SYFHFVGRIMGMAVFHGHYIDGGFTLPFYKQLLGKSITLDDMELVDPDLHNSLVWILEND
ITGVLDHTFCVEHNAYGEIIQHELKPNGKSIPVTEENKKEYVRLYVNWRFLRGIEAQFLA
LQKGFNEVIPQHLLKTFDEKELELIICGLGKIDVSDWKVNTRLKHCTPDSNVVKWFWKAV
EFFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHQIDACTNNLPKAHTCFNRI
DIPPYESYEKLYEKLLTAIEETCGFAVE
NT seq 2247 nt   +upstreamnt  +downstreamnt
atgtctaaccccggaggccggaggaacgggcccgtcaagctgcgcctgacagtactctgt
gcaaaaaacttggtgaaaaaggattttttccgtctccctgatccgtttgctaaggtggtg
gttgatggttctgggcagtgccattctacagatactgtgaagaacacacttgatccaaag
tggaatcagcattatgacctgtatatcggaaagtctgattcagttacgatcagtgtatgg
aatcataagaagatccataagaagcaaggtgctggatttcttggttgtgttcgtcttctt
tccaatgccatcaaccgcctcaaggacactggttatcaacggttggatttatgcaaactg
gggccaaatgacaatgatacagttcgaggacaaattgtagtaagtcttcaatccagagac
cggataggcacgggaggacaagttgtggactgtagtcgtttgtttgacaatgatttacca
gatggttgggaagaaaggcggactgcctctggaagaatccagtatctaaaccacatcaca
agaactacacagtgggaacgcccaacacgaccggcgtcagaatattctagtcctggcaga
ccccttagctgctttgtggatgagaatactccaattactggaacaaatggtgcaacgtgt
ggacagtcttcagaccccagactagcagagagaagagtcaggtcccagcgacatagaaat
tatatgagcaggacacacttacacactcctccagatctaccggaaggctatgaacagagg
acaacgcagcagggtcaggtgtatttcttgcatactcagactggtgtgagcacgtggcat
gatccacgagtgcctagggatcttagcaacatcaattgtgaagagctcggtcctttgcct
cctggatgggagatccgcaatactgcaacaggaagagtttatttcgttgaccataacaat
agaacaacacaatttacagatccccggctctctgctaacttgcatttagttttaaatcga
cagaaccagttgaaagatcaacagcaacagcaagtggtgtcgttgtgtcctgatgacact
gagtgtctgacagtgccaaggtacaagcgagatttggttcaaaaactaaaaatcttgcgg
caagaactttcccaacagcagcctcaagctggccactgccgcgttgaggtgtctagggaa
gagatttttgaggaatcatatcgacaggtcatgaaaatgaggccaaaagatctatggaag
cgattaatgataaaatttcgtggagaagaaggtcttgactatggaggagttgccagggaa
tggttgtatctcctgtcacatgaaatgttgaatccttactatggtctcttccagtattcc
agagatgatatctatacgttgcagatcaatcctgattctgcagttaatccggaacattta
tcctatttccactttgttggacggataatgggaatggctgtattccatggacattatatt
gacggtggcttcacattacctttttataaacagttgcttgggaagtcaattactttggat
gacatggagctagttgacccagaccttcataatagtttagtgtggatacttgaaaacgat
atcacaggtgttctggaccatactttctgtgttgagcataatgcctatggtgaaattatt
cagcatgaactcaaaccaaatggcaaaagtatccctgttactgaagaaaataaaaaagaa
tatgtcaggctttacgtcaactggagatttctccgaggcatcgaagctcagttcctggcg
ctgcagaagggctttaatgaagtcattccccagcatctgctgaagacatttgatgagaag
gagctggagctcattatttgtggacttggaaaaattgatgtgagtgactggaaggtcaac
acccggttaaaacactgtaccccagacagcaatgtcgtcaagtggttctggaaagctgtg
gagttttttgatgaagagagacgagcacggttactccagtttgtgacagggtcctctcga
gtgcctctgcagggcttcaaagcactacaaggtgctgcaggcccacggctctttaccata
caccagattgatgcctgcacgaacaacttgccaaaagcccacacttgcttcaatcgaata
gacattccaccctatgaaagctatgagaagctctatgaaaagctgctaacagccatcgag
gagacatgtggctttgctgtggaatga

KEGG   Mus pahari (shrew mouse): 110339179
Entry
110339179         CDS       T05929                                 

Gene name
Smurf1
Definition
(RefSeq) E3 ubiquitin-protein ligase SMURF1 isoform X1
  KO
K04678  E3 ubiquitin ligase SMURF1/2 [EC:2.3.2.26]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04120  Ubiquitin mediated proteolysis
mpah04144  Endocytosis
mpah04340  Hedgehog signaling pathway
mpah04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110339179 (Smurf1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110339179 (Smurf1)
   04350 TGF-beta signaling pathway
    110339179 (Smurf1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110339179 (Smurf1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110339179 (Smurf1)
   04121 Ubiquitin system [BR:mpah04121]
    110339179 (Smurf1)
   03029 Mitochondrial biogenesis [BR:mpah03029]
    110339179 (Smurf1)
Enzymes [BR:mpah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     110339179 (Smurf1)
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    110339179 (Smurf1)
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    110339179 (Smurf1)
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  HECT type E3
   110339179 (Smurf1)
Mitochondrial biogenesis [BR:mpah03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    110339179 (Smurf1)
SSDB
Motif
Pfam: HECT WW C2 HPS3_N
Other DBs
NCBI-GeneID: 110339179
NCBI-ProteinID: XP_021078379
Ensembl: MGP_PahariEiJ_G0024574
LinkDB
Position
23
AA seq 757 aa
MSNPGTRRNGSSIKIRLTVLCAKNLAKKDFFRLPDPFAKIVVDGSGQCHSTDTVKSTLDP
KWNQHYDLYVGKTDSITISVWNHKKIHKKQGAGFLGCVRLLSNAISRLKDTGYQRLDLCK
LNPSDTDAVRGQIVVSLQTRDRIGGGGSVVDCRGLLENEGTVYEDSGPGRPLSCLMEEPA
PYTDGTGAAAGGGNCRFVESPSQDQRLLVQRLRNPEVRGPLQTPQNRPHGHQSPELPEGY
EQRTTVQGQVYFLHTQTGVSTWHDPRIPSPLGTIPGGDEAFLYEFLLQGHTSEPRDLNSV
NCDELGPLPPGWEVRSTVSGRIYFVDHNNRTTQFTDPRLHHIMNHQCQLKEPSQPLQLPS
EGSVEDEELPAQRYERDLVQKLKVLRHELSLQQPQAGHCRIEVSREEIFEESYRQIMKMR
PKDLKKRLMVKFRGEEGLDYGGVAREWLYLLCHEMLNPYYGLFQYSTDNIYTLQINPDSS
INPDHLSYFHFVGRIMGLAVFHGHYINGGFTVPFYKQLLGKPIQLSDLESVDPELHKSLV
WILENDITPVLDHTFCVEHNAFGRILQHELKPNGRNVPVTEENKKEYVRLYVNWRFMRGI
EAQFLALQKGFNELIPQHLLKPFDQKELELIIGGLDKIDLNDWKSNTRLKHCVADSNIVR
WFWQAVETFDEERRARLLQFVTGSTRVPLQGFKALQGSTGAAGPRLFTIHLIDANTDNLP
KAHTCFNRIDIPPYESYEKLYEKLLTAVEETCGFAVE
NT seq 2274 nt   +upstreamnt  +downstreamnt
atgtcgaaccccgggacccgtaggaacggctccagcatcaagatccgtctgacagtattg
tgtgccaagaaccttgcaaagaaagacttcttcagactccccgacccctttgctaagatt
gttgtggacggctctgggcagtgccactcaaccgacactgtgaaaagcaccctggacccc
aagtggaaccagcactatgacctgtacgttgggaaaaccgactctataaccatcagcgtg
tggaaccacaagaagatccacaagaagcagggggctggcttcctgggctgtgtgcggctg
ctctccaatgccatcagcagattgaaagacactggctaccagcgtttggatctatgcaaa
ctaaatccctcagatactgacgcagttcgtggccaaatagtggtcagtttacagacccga
gacagaataggcggtggagggtcggtggtggactgcagagggctgctggagaacgaagga
acggtgtatgaagactcaggccctggaagaccactcagctgcctcatggaggaacctgcc
ccatatacagatggtactggcgcagcagcaggaggcgggaactgcaggtttgtggagtct
ccaagccaagatcagagactcctggtacagcgactccgaaatcctgaggttcgagggccc
ctacaaacgccccagaaccgaccacatggccaccagtcgccggagctgcctgaaggctat
gagcaaaggacaacagtgcagggacaagtttactttttgcacacacagactggagtcagc
acatggcatgaccccaggatccccagtcccttggggaccattccggggggagatgaagct
tttctatacgaattccttctacaaggccatacatccgagcccagagaccttaacagtgtg
aactgcgatgaacttgggccactgcctccaggctgggaagtcagaagcacagtgtcggga
agaatctattttgtagatcacaataataggacaacccagtttacagatccacggcttcac
cacatcatgaatcaccagtgccaactcaaggagcccagccagccgctgcagctgcccagc
gagggctccgtggaggacgaggagcttcctgcccagagatatgagagggacttagtccag
aagctcaaagttctcaggcacgagctttctcttcagcagccccaggctggtcactgtcgc
atagaagtctccagagaagagatatttgaggagtcgtatcgccagatcatgaagatgcgg
ccaaaagacctgaagaagcgcctgatggtgaagttccgaggggaggaaggtttggactat
ggtggagtggctcgggagtggctgtatttgttgtgccatgaaatgttgaatccgtattat
ggactcttccagtattccacggacaatatttatacactgcaaatcaacccagattcttct
atcaaccctgaccatctgtcttacttccactttgtgggtcgcatcatgggtctggctgtg
ttccacggacactacataaatgggggtttcacagttccgttctacaagcagctcctgggg
aaacccatccagctgtcggacctggagtccgtggacccagaactgcacaagagcttggtg
tggattctagagaatgacatcacgcctgtgctggatcataccttctgcgtggagcacaat
gctttcgggcggattcttcagcatgaactgaaacccaatggcagaaatgtgcctgtcact
gaggagaacaagaaggaatacgtccggctgtatgtgaactggaggtttatgagaggaatc
gaagcccagttcttagcgcttcagaaggggtttaacgaactcattccccagcacttgctg
aagccctttgaccaaaaggaactagagctgataataggcgggctggataagatagacctg
aacgactggaagtccaacacccggctgaagcactgtgtggcagacagcaacatcgtcagg
tggttctggcaggcggtggagaccttcgatgaggagaggagagccagactcctgcagttt
gtgacaggatccacaagggttcctctccaaggcttcaaggctctgcaaggctctacaggc
gcggcagggccccggctgttcaccattcacctgatagatgccaatacagacaacctaccc
aaggcccatacctgctttaatcggatcgacatcccaccctatgagtcctatgagaagctc
tatgagaagctgctgacagcggtggaggagacctgtggctttgctgtggagtga

DBGET integrated database retrieval system