KEGG   Mus pahari (shrew mouse): 110331414
Entry
110331414         CDS       T05929                                 

Gene name
Kif3a
Definition
(RefSeq) kinesin-like protein KIF3A isoform X1
  KO
K10394  kinesin family member 3A
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110331414 (Kif3a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mpah04812]
    110331414 (Kif3a)
Cytoskeleton proteins [BR:mpah04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     110331414 (Kif3a)
SSDB
Motif
Pfam: Kinesin Microtub_bd PIF1
Other DBs
NCBI-GeneID: 110331414
NCBI-ProteinID: XP_021067628
Ensembl: MGP_PahariEiJ_G0017475
LinkDB
Position
14
AA seq 725 aa
MPLNKSEKAESCDTVKVVVRCRPLNDREKSMCYRQAVSVDEMRGTITVHKTDSPNEPPKT
FTFDTVFGPESKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPGLR
GVIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQTQRLEVKERPDVGVY
IKDLSAYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGVDGNMH
VRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNS
KLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALL
RQFQKEIEELKKKLEEGEEVSGSDISGSEEDDEEGELGEDGEKRKKRRGSSSSSSSDSTC
SVIEKPLDEFLPHQAGKKKVSPDKMVEMQAKIDEERKALETKLDMEEEERNKARAELERR
EKDLLKAQQEHQSLLEKLSALEKKVIVGGVDLLAKAEEQEKLLEESNMELEERRRRAEQL
RKELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHQREIEGL
LENIRQLSRELRLQMLIIDNFIPQDYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRKQTP
VPDKKERDPFEVDLSHVYLAYTEESLRQSLMKLERPRTSKGKARPKTGRRKRSAKPETVI
DSLLQ
NT seq 2178 nt   +upstreamnt  +downstreamnt
atgccgctcaataagtcggagaaggcggaaagctgcgataccgtgaaggttgtagttagg
tgccggcctctcaatgacagagagaagtcaatgtgctatcgacaagccgtcagcgtggat
gaaatgaggggaactatcaccgtccataagaccgattcccccaacgaacctccgaagaca
tttactttcgatactgtttttggaccagaaagtaaacaacttgatgtgtacaacttaact
gcaagaccaattattgattctgttctggaaggctacaatgggaccatctttgcatatgga
cagactgggacaggcaagactttcaccatggaaggcgttcgcgcagtgccggggctcaga
ggggtcatccccaactcatttgctcacatttttggtcacatcgcaaaagcagagggagac
acaaggtttttggttcgagtgtcatacttggaaatatataatgaagaagttcgagacctt
ttgggtaaagatcagacccagaggttagaggttaaagaaaggcctgatgtgggagtatat
atcaaagatttatcagcatatgtagtcaacaacgctgacgacatggatagaatcatgact
ctaggccacaaaaaccgttctgttggtgcgactaatatgaacgagcacagttcccgatcc
cacgccatctttacaattactatagagtgcagcgagaaaggcgtggacgggaacatgcac
gtcaggatggggaagctccaccttgtggatcttgctgggtcagaaagacaagcaaaaact
ggagccacaggtcagcgcctcaaggaagctaccaaaatcaacctctcactgtctaccctg
ggcaatgtgatttctgccttggtggatggaaaaagcactcacgtgccatatcggaactcc
aaactgacccgtctcctgcaggattccttaggagggaactcaaaaaccatgatgtgtgca
aatattgggccagcagattataattatgatgaaactatcagtaccttgcggtatgccaac
cgcgccaagaacattaaaaacaaagcaagaattaatgaagacccaaaggatgctctgctt
cgccagtttcagaaagaaatagaagagctgaagaaaaagcttgaggaaggggaagaagtg
tcaggctctgacatcagtgggtcagaggaagatgacgaggagggtgaacttggagaagat
ggagaaaaaaggaaaaagagaaggggcagtagcagcagcagtagctcagactccacatgt
tctgtcatagagaagcccctggatgagttcttgcctcaccaagcaggtaaaaagaaagtt
tccccagataagatggtggaaatgcaagcgaaaattgatgaggagagaaaagcactggaa
accaaacttgacatggaagaagaagaaagaaacaaggctcgggctgaactagagagacgg
gagaaggaccttctgaaggcccaacaagagcatcagtctttgctggaaaaactgtctgct
ttggaaaagaaggtcattgtcggcggtgtggacttgttggccaaagctgaggagcaagag
aagcttcttgaggaatccaatatggagctggaggagcggaggagaagagctgagcaactt
cggaaagaactggaggaaaaagagcaagaacgcttggatatcgaggaaaaatataccagt
ctgcaagaggaggcacaaggaaagaccaagaaattaaagaaagtctggaccatgctgatg
gctgcaaagtcagagatggctgatctgcagcaggagcatcagagggagatcgaaggcctc
ctggagaacattcggcagctcagccgtgagcttcggcttcagatgcttatcattgataac
ttcatacctcaggattaccaggaaatgattgaaaactacgtccactggaatgaagacata
ggagaatggcagctaaaatgtgtggcctacacaggaaataacatgaggaaacaaactcca
gtccctgacaagaaggagagagacccgtttgaagtagacctttcccatgtgtacctcgcc
tatacagaggagagtctgcgtcagtctctgatgaagttagaaaggccacggacctccaag
gggaaagcaaggccaaagacggggcgaagaaagcgttctgcaaagcctgagaccgtaatt
gattctttacttcagtaa

DBGET integrated database retrieval system