KEGG   Mus pahari (shrew mouse): 110331528
Entry
110331528         CDS       T05929                                 

Gene name
Rac3
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 3 isoform X1
  KO
K07861  Ras-related C3 botulinum toxin substrate 3
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04024  cAMP signaling pathway
mpah04062  Chemokine signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04310  Wnt signaling pathway
mpah04360  Axon guidance
mpah04370  VEGF signaling pathway
mpah04510  Focal adhesion
mpah04520  Adherens junction
mpah04650  Natural killer cell mediated cytotoxicity
mpah04662  B cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04810  Regulation of actin cytoskeleton
mpah05135  Yersinia infection
mpah05163  Human cytomegalovirus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
mpah05210  Colorectal cancer
mpah05212  Pancreatic cancer
mpah05231  Choline metabolism in cancer
mpah05416  Viral myocarditis
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110331528 (Rac3)
   04014 Ras signaling pathway
    110331528 (Rac3)
   04015 Rap1 signaling pathway
    110331528 (Rac3)
   04310 Wnt signaling pathway
    110331528 (Rac3)
   04370 VEGF signaling pathway
    110331528 (Rac3)
   04071 Sphingolipid signaling pathway
    110331528 (Rac3)
   04024 cAMP signaling pathway
    110331528 (Rac3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110331528 (Rac3)
   04520 Adherens junction
    110331528 (Rac3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110331528 (Rac3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110331528 (Rac3)
   04662 B cell receptor signaling pathway
    110331528 (Rac3)
   04664 Fc epsilon RI signaling pathway
    110331528 (Rac3)
   04062 Chemokine signaling pathway
    110331528 (Rac3)
  09158 Development and regeneration
   04360 Axon guidance
    110331528 (Rac3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110331528 (Rac3)
   05231 Choline metabolism in cancer
    110331528 (Rac3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110331528 (Rac3)
   05212 Pancreatic cancer
    110331528 (Rac3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110331528 (Rac3)
   05163 Human cytomegalovirus infection
    110331528 (Rac3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110331528 (Rac3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110331528 (Rac3)
   05416 Viral myocarditis
    110331528 (Rac3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mpah04031]
    110331528 (Rac3)
GTP-binding proteins [BR:mpah04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    110331528 (Rac3)
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 110331528
NCBI-ProteinID: XP_021067870
Ensembl: MGP_PahariEiJ_G0018668
LinkDB
Position
14
AA seq 238 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLR
DDKDTIERLRDKKLAPITYPQGLAMAREIGEFCQVPGVLSSDPERSEDSVRRGHPGCALP
TSSEKARQEVHCVLDPCLASLAVERWLKCTLVLSCLMSLSLLWEVLWVGRGSMGTRLG
NT seq 717 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgcgtggtggttggcgatggtgccgtggggaagacatgcctgctg
atcagctacacgaccaacgccttcccaggagaatatatccccacagttttcgacaactac
tcagccaacgtgatggtggatggaaagccagtcaacctggggctgtgggacactgctggc
caggaagactacgataggcttcggccactctcctatcctcaaaccgatgtctttctgatc
tgcttctccctggtgagcccagcctcctttgagaacgtccgtgccaagtggtacccagag
gtgcggcaccactgcccacacacacccatccttctggtgggcaccaagctggacctccgt
gatgacaaggatacgattgaacggctgcgggacaagaagctggcacccatcacttacccc
caaggcctggccatggcccgagagatcggtgagttctgtcaagtacctggagtgctcagc
tctgacccagagaggtctgaagacagtgttcgacgaggccatccgggctgtgctctgccc
acctccagtgaaaaagccaggcaagaagtgcactgtgttctagatccttgcctggccagc
ctggctgtagagcgctggctcaagtgtaccctcgtgttgagctgtctgatgtccctgagt
ctgctgtgggaagtgttgtgggtgggcaggggaagcatggggacaaggctggggtga

KEGG   Mus pahari (shrew mouse): 110334678
Entry
110334678         CDS       T05929                                 

Gene name
Rac2
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 2 isoform X1
  KO
K07860  Ras-related C3 botulinum toxin substrate 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04024  cAMP signaling pathway
mpah04062  Chemokine signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04310  Wnt signaling pathway
mpah04360  Axon guidance
mpah04370  VEGF signaling pathway
mpah04510  Focal adhesion
mpah04520  Adherens junction
mpah04613  Neutrophil extracellular trap formation
mpah04650  Natural killer cell mediated cytotoxicity
mpah04662  B cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04666  Fc gamma R-mediated phagocytosis
mpah04670  Leukocyte transendothelial migration
mpah04810  Regulation of actin cytoskeleton
mpah05020  Prion disease
mpah05135  Yersinia infection
mpah05163  Human cytomegalovirus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
mpah05210  Colorectal cancer
mpah05212  Pancreatic cancer
mpah05231  Choline metabolism in cancer
mpah05415  Diabetic cardiomyopathy
mpah05416  Viral myocarditis
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110334678 (Rac2)
   04014 Ras signaling pathway
    110334678 (Rac2)
   04015 Rap1 signaling pathway
    110334678 (Rac2)
   04310 Wnt signaling pathway
    110334678 (Rac2)
   04370 VEGF signaling pathway
    110334678 (Rac2)
   04071 Sphingolipid signaling pathway
    110334678 (Rac2)
   04024 cAMP signaling pathway
    110334678 (Rac2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110334678 (Rac2)
   04520 Adherens junction
    110334678 (Rac2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110334678 (Rac2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110334678 (Rac2)
   04650 Natural killer cell mediated cytotoxicity
    110334678 (Rac2)
   04662 B cell receptor signaling pathway
    110334678 (Rac2)
   04664 Fc epsilon RI signaling pathway
    110334678 (Rac2)
   04666 Fc gamma R-mediated phagocytosis
    110334678 (Rac2)
   04670 Leukocyte transendothelial migration
    110334678 (Rac2)
   04062 Chemokine signaling pathway
    110334678 (Rac2)
  09158 Development and regeneration
   04360 Axon guidance
    110334678 (Rac2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110334678 (Rac2)
   05231 Choline metabolism in cancer
    110334678 (Rac2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110334678 (Rac2)
   05212 Pancreatic cancer
    110334678 (Rac2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110334678 (Rac2)
   05163 Human cytomegalovirus infection
    110334678 (Rac2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110334678 (Rac2)
  09164 Neurodegenerative disease
   05020 Prion disease
    110334678 (Rac2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110334678 (Rac2)
   05415 Diabetic cardiomyopathy
    110334678 (Rac2)
   05416 Viral myocarditis
    110334678 (Rac2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mpah04031]
    110334678 (Rac2)
GTP-binding proteins [BR:mpah04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    110334678 (Rac2)
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 110334678
NCBI-ProteinID: XP_021072164
Ensembl: MGP_PahariEiJ_G0019990
LinkDB
Position
17
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLR
DDKDTIEKLKEKKLAPITYPQGLALAKDIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTRQQKRPCSLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggtgatggagccgtgggcaagacgtgtcttctc
atcagctacaccaccaacgccttccccggagaatacatccccactgtatttgacaactac
tcagccaatgtgatggtggacagtaagcccgtgaacctggggctgtgggataccgcaggt
caggaggactatgaccgcctccggccgctctcctacccacagacagatgtatttctcatc
tgcttctcgctagtcagcccggcctcctatgagaacgtccgtgccaagtggttccctgaa
gtacggcaccactgccccagcacccctatcatcctggtgggtaccaagctggaccttcgc
gatgacaaggacaccatcgagaagttgaaggagaagaagctggctcccatcacctacccg
cagggcctggcactggccaaggatattgattcagtcaagtatttggaatgctctgccctc
acccagcgaggcctgaagaccgtctttgatgaggcaatccgagcagtcctctgcccacag
cccacacgacagcagaagcgcccctgcagcctgctctag

KEGG   Mus pahari (shrew mouse): 110339030
Entry
110339030         CDS       T05929                                 

Gene name
Rac1
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 1 isoform X1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04024  cAMP signaling pathway
mpah04062  Chemokine signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04145  Phagosome
mpah04151  PI3K-Akt signaling pathway
mpah04310  Wnt signaling pathway
mpah04360  Axon guidance
mpah04370  VEGF signaling pathway
mpah04380  Osteoclast differentiation
mpah04510  Focal adhesion
mpah04520  Adherens junction
mpah04530  Tight junction
mpah04613  Neutrophil extracellular trap formation
mpah04620  Toll-like receptor signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah04662  B cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04666  Fc gamma R-mediated phagocytosis
mpah04670  Leukocyte transendothelial migration
mpah04722  Neurotrophin signaling pathway
mpah04810  Regulation of actin cytoskeleton
mpah04932  Non-alcoholic fatty liver disease
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04972  Pancreatic secretion
mpah05014  Amyotrophic lateral sclerosis
mpah05020  Prion disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05100  Bacterial invasion of epithelial cells
mpah05132  Salmonella infection
mpah05135  Yersinia infection
mpah05163  Human cytomegalovirus infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
mpah05203  Viral carcinogenesis
mpah05205  Proteoglycans in cancer
mpah05208  Chemical carcinogenesis - reactive oxygen species
mpah05210  Colorectal cancer
mpah05211  Renal cell carcinoma
mpah05212  Pancreatic cancer
mpah05231  Choline metabolism in cancer
mpah05415  Diabetic cardiomyopathy
mpah05416  Viral myocarditis
mpah05417  Lipid and atherosclerosis
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110339030 (Rac1)
   04014 Ras signaling pathway
    110339030 (Rac1)
   04015 Rap1 signaling pathway
    110339030 (Rac1)
   04310 Wnt signaling pathway
    110339030 (Rac1)
   04370 VEGF signaling pathway
    110339030 (Rac1)
   04071 Sphingolipid signaling pathway
    110339030 (Rac1)
   04024 cAMP signaling pathway
    110339030 (Rac1)
   04151 PI3K-Akt signaling pathway
    110339030 (Rac1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110339030 (Rac1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110339030 (Rac1)
   04520 Adherens junction
    110339030 (Rac1)
   04530 Tight junction
    110339030 (Rac1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110339030 (Rac1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110339030 (Rac1)
   04620 Toll-like receptor signaling pathway
    110339030 (Rac1)
   04650 Natural killer cell mediated cytotoxicity
    110339030 (Rac1)
   04662 B cell receptor signaling pathway
    110339030 (Rac1)
   04664 Fc epsilon RI signaling pathway
    110339030 (Rac1)
   04666 Fc gamma R-mediated phagocytosis
    110339030 (Rac1)
   04670 Leukocyte transendothelial migration
    110339030 (Rac1)
   04062 Chemokine signaling pathway
    110339030 (Rac1)
  09154 Digestive system
   04972 Pancreatic secretion
    110339030 (Rac1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110339030 (Rac1)
  09158 Development and regeneration
   04360 Axon guidance
    110339030 (Rac1)
   04380 Osteoclast differentiation
    110339030 (Rac1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110339030 (Rac1)
   05205 Proteoglycans in cancer
    110339030 (Rac1)
   05208 Chemical carcinogenesis - reactive oxygen species
    110339030 (Rac1)
   05203 Viral carcinogenesis
    110339030 (Rac1)
   05231 Choline metabolism in cancer
    110339030 (Rac1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110339030 (Rac1)
   05212 Pancreatic cancer
    110339030 (Rac1)
   05211 Renal cell carcinoma
    110339030 (Rac1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110339030 (Rac1)
   05163 Human cytomegalovirus infection
    110339030 (Rac1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110339030 (Rac1)
   05169 Epstein-Barr virus infection
    110339030 (Rac1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110339030 (Rac1)
   05135 Yersinia infection
    110339030 (Rac1)
   05100 Bacterial invasion of epithelial cells
    110339030 (Rac1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    110339030 (Rac1)
   05020 Prion disease
    110339030 (Rac1)
   05022 Pathways of neurodegeneration - multiple diseases
    110339030 (Rac1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110339030 (Rac1)
   05418 Fluid shear stress and atherosclerosis
    110339030 (Rac1)
   05415 Diabetic cardiomyopathy
    110339030 (Rac1)
   05416 Viral myocarditis
    110339030 (Rac1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110339030 (Rac1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110339030 (Rac1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110339030 (Rac1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110339030 (Rac1)
   04031 GTP-binding proteins [BR:mpah04031]
    110339030 (Rac1)
Membrane trafficking [BR:mpah04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    110339030 (Rac1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    110339030 (Rac1)
  Macropinocytosis
   Ras GTPases
    110339030 (Rac1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    110339030 (Rac1)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110339030 (Rac1)
  Exosomal proteins of other body fluids (saliva and urine)
   110339030 (Rac1)
  Exosomal proteins of colorectal cancer cells
   110339030 (Rac1)
  Exosomal proteins of bladder cancer cells
   110339030 (Rac1)
GTP-binding proteins [BR:mpah04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    110339030 (Rac1)
SSDB
Motif
Pfam: Ras Roc Arf CagD
Other DBs
NCBI-GeneID: 110339030
NCBI-ProteinID: XP_021078140
Ensembl: MGP_PahariEiJ_G0024554
LinkDB
Position
23
AA seq 211 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTVGDTCGKDRTSRGKDKPIADVFLICFSLVSPASFENVRAKWYPEV
RHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALT
QRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL
NT seq 636 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagctgttggtaaaacctgcctgctc
atcagttacacgaccaatgcctttcctggagagtacatccccactgtctttgacaactat
tctgccaatgttatggtagatggaaaaccagtgaatctgggcctatgggacacagctgga
caagaagattatgacaggttgcgtcccctctcctacccgcaaacagttggagacacatgt
ggtaaagatagaacctccaggggcaaagacaagccgattgccgacgtgttcttaatttgc
ttttcccttgtgagtcctgcatcatttgaaaatgtccgtgcaaagtggtatcctgaagtg
cgacaccactgtcccaatacacctatcatcctagtggggacgaagcttgatcttcgggat
gataaggacacgattgagaagctgaaggagaagaagctcactcccatcacctacccgcag
gggctagccatggcgaaagagatcggtgctgtcaaatacctggagtgctcagctctcaca
cagcgaggactcaagacagtgtttgacgaagctatccgagcagttctctgtccccctcct
gtcaagaagaggaagagaaaatgcctgctgttgtaa

DBGET integrated database retrieval system