KEGG   Mus pahari (shrew mouse): 110331731
Entry
110331731         CDS       T05929                                 

Gene name
Tp53
Definition
(RefSeq) cellular tumor antigen p53 isoform X1
  KO
K04451  tumor protein p53
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01522  Endocrine resistance
mpah01524  Platinum drug resistance
mpah04010  MAPK signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04110  Cell cycle
mpah04115  p53 signaling pathway
mpah04137  Mitophagy - animal
mpah04151  PI3K-Akt signaling pathway
mpah04210  Apoptosis
mpah04211  Longevity regulating pathway
mpah04216  Ferroptosis
mpah04218  Cellular senescence
mpah04310  Wnt signaling pathway
mpah04722  Neurotrophin signaling pathway
mpah04919  Thyroid hormone signaling pathway
mpah05012  Parkinson disease
mpah05014  Amyotrophic lateral sclerosis
mpah05016  Huntington disease
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05203  Viral carcinogenesis
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05210  Colorectal cancer
mpah05212  Pancreatic cancer
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05216  Thyroid cancer
mpah05217  Basal cell carcinoma
mpah05218  Melanoma
mpah05219  Bladder cancer
mpah05220  Chronic myeloid leukemia
mpah05222  Small cell lung cancer
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05230  Central carbon metabolism in cancer
mpah05417  Lipid and atherosclerosis
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110331731 (Tp53)
   04310 Wnt signaling pathway
    110331731 (Tp53)
   04071 Sphingolipid signaling pathway
    110331731 (Tp53)
   04151 PI3K-Akt signaling pathway
    110331731 (Tp53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    110331731 (Tp53)
  09143 Cell growth and death
   04110 Cell cycle
    110331731 (Tp53)
   04210 Apoptosis
    110331731 (Tp53)
   04216 Ferroptosis
    110331731 (Tp53)
   04115 p53 signaling pathway
    110331731 (Tp53)
   04218 Cellular senescence
    110331731 (Tp53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    110331731 (Tp53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110331731 (Tp53)
  09149 Aging
   04211 Longevity regulating pathway
    110331731 (Tp53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110331731 (Tp53)
   05202 Transcriptional misregulation in cancer
    110331731 (Tp53)
   05206 MicroRNAs in cancer
    110331731 (Tp53)
   05205 Proteoglycans in cancer
    110331731 (Tp53)
   05203 Viral carcinogenesis
    110331731 (Tp53)
   05230 Central carbon metabolism in cancer
    110331731 (Tp53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110331731 (Tp53)
   05212 Pancreatic cancer
    110331731 (Tp53)
   05225 Hepatocellular carcinoma
    110331731 (Tp53)
   05226 Gastric cancer
    110331731 (Tp53)
   05214 Glioma
    110331731 (Tp53)
   05216 Thyroid cancer
    110331731 (Tp53)
   05220 Chronic myeloid leukemia
    110331731 (Tp53)
   05217 Basal cell carcinoma
    110331731 (Tp53)
   05218 Melanoma
    110331731 (Tp53)
   05219 Bladder cancer
    110331731 (Tp53)
   05215 Prostate cancer
    110331731 (Tp53)
   05213 Endometrial cancer
    110331731 (Tp53)
   05224 Breast cancer
    110331731 (Tp53)
   05222 Small cell lung cancer
    110331731 (Tp53)
   05223 Non-small cell lung cancer
    110331731 (Tp53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110331731 (Tp53)
   05161 Hepatitis B
    110331731 (Tp53)
   05160 Hepatitis C
    110331731 (Tp53)
   05162 Measles
    110331731 (Tp53)
   05168 Herpes simplex virus 1 infection
    110331731 (Tp53)
   05163 Human cytomegalovirus infection
    110331731 (Tp53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110331731 (Tp53)
   05169 Epstein-Barr virus infection
    110331731 (Tp53)
   05165 Human papillomavirus infection
    110331731 (Tp53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    110331731 (Tp53)
   05014 Amyotrophic lateral sclerosis
    110331731 (Tp53)
   05016 Huntington disease
    110331731 (Tp53)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110331731 (Tp53)
   05418 Fluid shear stress and atherosclerosis
    110331731 (Tp53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110331731 (Tp53)
   01522 Endocrine resistance
    110331731 (Tp53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110331731 (Tp53)
   03036 Chromosome and associated proteins [BR:mpah03036]
    110331731 (Tp53)
   03400 DNA repair and recombination proteins [BR:mpah03400]
    110331731 (Tp53)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    110331731 (Tp53)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     110331731 (Tp53)
DNA repair and recombination proteins [BR:mpah03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    110331731 (Tp53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD CEP1-DNA_bind
Other DBs
NCBI-GeneID: 110331731
NCBI-ProteinID: XP_021068233
Ensembl: MGP_PahariEiJ_G0017705
LinkDB
Position
14
AA seq 391 aa
MEDSQSDISLELPLSQETFSGLWKLLPPEVNLPTSVPSPNSMDELFLSPDVAELFEGPNE
ALHVLAAPAAQDPVTETPGPMAPAPATPWPLSSFVPSQKTYQGNYGFRLGFLQSGTAKSV
TCTYSPPLNKLFCQLAKTCPVQLWVNATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERC
SDGDGLAPPQHLIRVEGNLYAEYLEDRQTFRHSVVVPYEPPEVGSEYTAIHYKFMCNSSC
MGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEDPCPELPPG
SAKRALPTCTSASPQQKKKPLDGECFILKIRGRERFEMFRELNEALELKDARAAEESGDS
RAHSSYLKTKRGQSTSRHKKTMVKKVGPDSD
NT seq 1176 nt   +upstreamnt  +downstreamnt
atggaggactcacagtcagatatcagcctcgagctccctctgagtcaggagacattttca
ggcttatggaaactacttcctccagaagttaacctgcccacctcggtgccatcgcctaac
tccatggatgagttgttcctgtccccggatgttgcggagttgtttgaaggcccaaatgaa
gccctccacgtgttggcagctcctgcagcacaggaccctgtcaccgagacccctgggccc
atggcccctgcaccagccactccgtggcccctgtcatcttttgtaccttctcaaaaaact
taccaaggcaactacggcttccgcctgggcttcctgcagtctggaacagccaagtctgtt
acgtgcacgtactcccctcccctcaataagctattctgccagctggcaaagacgtgccct
gtacagttgtgggtcaacgccacacctccagctgggagccgtgtccgcgccatggccatc
tacaagaagtcacagcacatgacagaggtcgtgagacgctgcccccaccatgagcgctgc
tccgatggtgatggcctggctcctccccagcatcttatccgggtcgaaggaaatttgtat
gctgagtatctggaagacaggcagacttttcgccacagcgtggtggtaccgtatgagcca
cctgaggtcggttctgagtacaccgccatccactacaagttcatgtgtaacagctcctgc
atggggggcatgaaccgccgacctatccttaccatcatcacactggaagactccagtggg
aacctcctgggacgggacagctttgaggttcgtgtttgtgcctgccctgggagagaccgg
cgtacagaggaagaaaatttccgcaaaaaggaagacccttgccccgagctgcccccgggg
agcgcgaagagagcactgcccacctgcacaagtgcctctccccagcaaaagaaaaaacca
cttgatggagagtgtttcatcctcaagatccgcgggcgtgaacgattcgagatgttccgg
gagctgaatgaggccttagagttaaaagatgcccgcgctgcagaggagtcgggagacagc
agggctcactccagctacctgaagaccaagaggggccagtctacttcccgccataaaaaa
acaatggtcaagaaagtggggcctgactcagactga

DBGET integrated database retrieval system