KEGG   Mus pahari (shrew mouse): 110331961
Entry
110331961         CDS       T05929                                 
Symbol
Cntnap1
Name
(RefSeq) contactin-associated protein 1
  KO
K07379  contactin associated protein 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110331961 (Cntnap1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mpah04990]
    110331961 (Cntnap1)
Domain-containing proteins not elsewhere classified [BR:mpah04990]
 Laminin domain-containing proteins
  Laminin G domain-containing proteins
   110331961 (Cntnap1)
SSDB
Motif
Pfam: Laminin_G_2 Laminin_G_1 F5_F8_type_C EGF
Other DBs
NCBI-GeneID: 110331961
NCBI-ProteinID: XP_021068507
Ensembl: MGP_PahariEiJ_G0018332
LinkDB
Position
14:68640949..68655308
AA seq 1381 aa
MMRLRLFSILLATVVSGARGWGYYGCNEELVGPLYARSLGASSYYGLFTTARFARLHGIS
GWSPRIGDPNPWLQIDLMKKHRIRAVATQGAFNSWDWVTRYMLLYGDRVDSWTPFYQQGH
NATFFGNVNDSAVVRHDLHYHFTARYIRIVPLAWNPRGKIGLRLGIYGCPYTSNILYFDG
DDAISYRFQRGASQSLWDVFAFSFKTEEKDGLLLHTEGSQGDYVTLELQGAHLLLHMSLG
SSPIQPRPGHTTVSAGGVLNDLSWHYVRVDRYGRDANLTLDGYAHHFVLNGDFERLNLEN
EIFIGGLVGAARKNLAYRHNFRGCIENVIYNRINIAEMAVMRHSRITFEGNVAFRCLDPV
PHPINFGGPHNFVQVPGFPRRGRLAVSFRFRTWDLTGLLLFSHMGDGLGHVELMLSEGQV
NVSIAQTGRKKLQFAAGYRLNDGFWHEVNFVAQENHAVISIDDVEGAEVRVSYPLLIRTG
TSYFFGGCPKPASRWGCHSNQTAFHGCMELLKVDGQLVNLTLVEFRKLGYFAEVLFDTCG
ITDRCSPNMCEHDGRCYQSWDDFICYCELTGYKGVTCHEPLYKESCEAYRLSGKYSGNYT
IDPDGSGPLKPFVVYCDIRENRAWTVVRHDRLWTTRVTGSSMDRPFLGAIQYWNASWEEV
SALANASQHCEQWIEFSCYNSRLLNTAGGYPYSFWIGRNEEQHFYWGGSQPGIQRCACGL
DQSCVDPALHCNCDADQPQWRTDKGLLTFVDHLPVTQVVVGDTNRSNSEAQFFLRPLRCY
GDRNSWNTISFHTGAALRFPPIRANHSLDVSFYFRTSAPSGVFLENMGGPFCRWRRPYVR
VELNTSRDVVFAFDIGNGDENLTVHSDDFEFNDDEWHLVRAEINVKQARLRVDHRPWVLR
PMPLQTYIWLVYDQPLYVGSAELKRRPFVGCLRAMRLNGVTLNLEGRANASEGTFPNCTG
HCTHPRFPCFHGGRCVERYSYYTCDCDLTAFDGPYCNHDIGGFFETGTWMRYNLQSALRS
AAREFSHMLSRPVPGYEPGYIPGYDTPGYVPGYHGPGYRLPEYPRPGRPVPGYRGPVYNI
TGEEVSFSFSTSSAPAVLLYVSSFVRDYMAVLIKEDGTLQLRYQLGTSPYVYQLTTRPVT
DGQPHSVNITRVYRNLFIQVDYFPLTEQKFSLLVDSQLDSPKALYLGRVMETGIIDPEIQ
RYNTPGFSGCLSGVRFNNVAPLKTHFRTPRPMTAELAEAMRVQGELSESNCGAMPRLVSE
VPPELDPWYLPPDFPYYHDDGWIAILLGFLVAFLLLGLVGMLVLFYLQNHRYKGSYHTNE
PKATHDSHPGGKAPLPPSGPAQAPAPTPAPTQVPAPAPAPASGPGPRDQNLPQILEESRS
E
NT seq 4146 nt   +upstreamnt  +downstreamnt
atgatgcgtctccggctcttcagcatcctgctcgccacggtggtctctggagctcggggc
tggggctactacggttgcaatgaggagctggtggggcctctgtatgcacggtctctgggc
gcttcctcctactatggactctttaccacagcccgctttgcccggctacacggcatcagt
ggatggtcgccccggattggggacccgaatccctggctgcagatcgacttaatgaagaaa
catcggatccgggctgtggccacacagggagcctttaattcttgggattgggtcacacgt
tacatgttgctctacggggaccgtgtggacagctggacgccattctaccaacaagggcat
aacgcgaccttcttcggtaatgtcaatgactcggcagtggtccgccatgaccttcactac
cactttacggctcgctacatccgcatcgtgccactggcctggaacccgcgcggcaagatc
ggcttgaggctgggcatctatggttgtccctacacatccaatatcctgtattttgacggc
gacgatgccatctcataccgcttccagcgaggcgccagccaaagtctttgggacgtgttc
gcttttagtttcaagacagaggagaaggatgggctgttgctgcacaccgagggctcccag
ggggattatgtgacactagaactgcaaggggcacacctgctgctgcacatgagcctgggc
agcagtcccattcagccaagacctggtcacaccacggtgagcgctggtggcgttcttaac
gacctaagctggcactatgtgcgggtggatcgatatggccgggatgcaaatctcaccctg
gatggttacgcccatcactttgtgctcaacggcgactttgaaaggctgaatctcgaaaat
gagatattcatcgggggtctagtgggcgcagcacgtaagaacctggcctaccgtcataac
ttccgtggctgcatagaaaacgtgatctacaaccggatcaacattgcagaaatggcagtg
atgcgccattcgcggatcaccttcgagggtaatgtggctttccgttgcttggatcccgtt
ccacaccccatcaacttcggaggccctcacaacttcgtccaagtgcctggctttccacgc
cgaggccgcttagcagtctcctttcgcttccgcacctgggacctcacagggctgctcctt
ttctcccacatgggggacgggctgggtcatgtggagctgatgcttagcgaagggcaagtc
aatgtatccatcgcgcagactggccgcaagaagcttcagtttgctgctgggtaccgcctg
aatgatggcttctggcatgaggtgaattttgtggcacaggaaaaccatgcagtcatcagt
attgatgatgtggaaggggcagaggtcagggtttcatacccactgctgatccgcacaggg
acttcatacttctttggtggttgtcccaaaccagccagtcgatggggctgccactccaac
cagacagcattccatggctgcatggagctgctcaaggtggacggtcaactggtcaacctc
actctggtagagtttcggaagctcggttactttgctgaggtcctctttgacacatgtggc
atcacagacagatgcagccctaacatgtgtgagcatgatggacgatgctaccagtcttgg
gatgacttcatctgctactgcgaacttaccggctacaagggagttacctgccacgaaccg
ttgtacaaggagtcctgtgaggcttatcggctcagtgggaaatattctggaaactacacc
attgatcctgatggcagtggacccctgaagccatttgtggtgtattgtgacatccgagag
aaccgagcgtggacagttgtgcggcatgacaggctgtggaccactcgagtgactggttcc
agcatggatcggccctttctgggggccatccaatactggaatgcctcctgggaggaagtc
agcgccctggccaacgcttcccaacactgtgagcagtggatcgagttctcctgctacaat
tctcggctgctcaacactgcaggaggctacccctacagcttttggattggccgcaatgag
gaacagcatttctactggggaggctcccagcctgggatccagcgctgtgcctgtgggctg
gaccagagctgtgtggaccctgcactgcactgcaattgtgatgccgaccagccacagtgg
agaacagacaaggggctcctgacctttgtagaccatctgcctgtcactcaggtagtggta
ggtgatacaaaccgctcaaattctgaagctcagttcttcctgaggcctctgcgctgctat
ggtgaccgcaattcctggaacaccatctccttccacaccggagctgcactgcgtttccct
ccaatccgagccaaccacagccttgacgtctccttctacttcaggacctcggctccctca
ggtgtcttcctggagaacatggggggtcctttttgccggtggcgccgaccttacgtgaga
gtggagctcaacacatcccgggatgtggtctttgcctttgatattggcaatggggatgag
aacctgacagtgcactcggatgactttgagtttaacgatgatgagtggcatttggtccga
gctgaaatcaacgtgaagcaggcccggctgcgagtggatcaccggccctgggtgctaagg
cccatgcccctgcagacctacatctggctggtgtatgaccaacccctctatgtgggatct
gccgagcttaagaggcgcccttttgtgggctgcttgagggccatgcgtttgaatggagtg
actctgaacttggagggccgtgccaatgcctctgagggcaccttccccaactgcacgggc
cactgcacccacccccggttcccctgtttccatggaggacgctgtgtggagcgatacagc
tactacacatgtgactgtgacctcacagcttttgatgggccgtattgcaatcatgatatt
ggcggattctttgagactggcacatggatgcgctataacctccagtcagcactgcgctct
gcggcccgggagttctctcacatgctgagccggccagtgcctggctatgagcctggctat
attccaggctacgacactcctggttacgtgcccgggtatcatggccctgggtaccgtctg
cccgagtacccgaggcctggccggccagtgcccgggtatcgagggcctgtctacaatatt
actggagaggaggtctccttcagcttcagcaccagctctgctcctgcagtcctgctctat
gtcagctccttcgtacgtgactacatggctgtgctcatcaaggaggatgggaccctacag
cttcggtatcagttgggcaccagtccctacgtgtaccagctaaccacccggccagtgact
gatggccagccccatagtgtcaacatcacccgggtctaccgaaacctctttatccaggtg
gactacttcccgctgacagaacagaagttctccctcctggtggacagccagctggactca
cccaaggccttgtatctagggcgtgtgatggagacaggaatcattgacccagagattcag
cggtacaacaccccaggtttctcaggctgcctttctggtgtccggttcaacaatgtggct
cctctcaagacccatttccgaacccctcgccccatgactgctgagctggcggaggccatg
cgggttcaaggagaactgtcagaatctaactgtggagctatgccacgccttgtctctgag
gtgccaccggaacttgatccctggtacctgcccccagatttcccatactaccatgatgac
ggatggattgccatactcttaggctttttggtggccttcctgttgctggggcttgtggga
atgctggtgctgttctatctgcaaaatcatcgatacaagggctcctaccacaccaacgag
cccaaggccacccacgattcccatcctggtggcaaagctcccctccctccctcaggcccc
gcccaggcccctgcccctactccagctcccacacaggttccagccccagccccagcgcca
gcctctggccccggccccagggatcagaacctcccccagatcttggaggagtccaggtct
gaatga

DBGET integrated database retrieval system