KEGG   Mus pahari (shrew mouse): 110332069
Entry
110332069         CDS       T05929                                 
Symbol
Vtn
Name
(RefSeq) vitronectin
  KO
K06251  vitronectin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04151  PI3K-Akt signaling pathway
mpah04510  Focal adhesion
mpah04512  ECM-receptor interaction
mpah04610  Complement and coagulation cascades
mpah05165  Human papillomavirus infection
mpah05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110332069 (Vtn)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110332069 (Vtn)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110332069 (Vtn)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110332069 (Vtn)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110332069 (Vtn)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110332069 (Vtn)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110332069 (Vtn)
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110332069 (Vtn)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110332069 (Vtn)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   110332069 (Vtn)
SSDB
Motif
Pfam: Hemopexin Somatomedin_B
Other DBs
NCBI-GeneID: 110332069
NCBI-ProteinID: XP_021068694
Ensembl: MGP_PahariEiJ_G0017945
LinkDB
Position
14:46241014..46244179
AA seq 478 aa
MAPLRPFFILALVAWVSLADQESCKGRCTQGFMASRKCQCDELCTYYQSCCDDYMEQCKP
QVTRGDVFTMPEDDYWSYDYVEETKNNTNTGVQPENTPLPADLKPPTESTVKPTAFLDPE
EQLSALAPEVEQEGVILSPDTTDQGTAEFPEEVLCSGKPFDAFTDLKNGSLFAFRGQYCY
ELDETAVRPGYPKLIQDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPGYPR
NISEGFSGIPDNVDAAFALPAHRYSGRERVYFFKGKQYWEYKFQQQPSQEECGGSSLSAV
FEHFALLQRDSWENIFELLFWGRSSDGARGPQFISRDWHGVPGKVDAAMTGRIYVTGSTS
HSAQAKKPKSKRRSRKRYRSHRGRGHRRSHSLNSRRPSRSIWFSSFSSEESGLGTYNNYD
YDMDWLVPATCEPIQSVYFFSGDKYYRVNLRTQRVDSVNPPYPRSIAQYWLGCPTSEK
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggcacctctgaggccctttttcatattagccctggtggcatgggtttctctggctgac
caagagtcatgcaagggccgctgcactcagggtttcatggccagcaggaagtgtcaatgt
gacgagctttgcacttattatcagagctgctgtgatgactacatggagcagtgtaagccc
caagtgactcggggggacgtgttcactatgccagaagatgattattggagctatgactac
gtggaggagaccaagaacaataccaacactggtgtgcagcccgagaacacccctctaccc
gctgacctaaagcctccgacggaaagcactgtaaagccgacagccttcctagatcctgag
gaacagctgagcgccctagcgcctgaagtggagcaagaaggggtgatcctaagtcctgac
accactgatcaggggaccgctgagttcccagaggaagtactgtgcagtggaaagcccttt
gatgccttcacagacctaaagaatgggtccctctttgccttccgagggcagtactgctat
gagctagacgagacggcagtgaggcctgggtaccccaaactcatccaagatgtctggggc
attgagggccccatcgatgctgccttcactcgcatcaactgtcaggggaagacctacttg
ttcaagggtagtcagtactggcgctttgaggatggggtcctggaccctggctatccccga
aatatctcggaaggcttcagtggcataccagacaatgttgatgcagcgttcgcccttcct
gcccaccgttacagtggccgggaaagggtctactttttcaaggggaagcagtactgggag
tacaaatttcagcagcagcccagccaggaggaatgtggaggcagctctctgtcagccgtg
ttcgagcactttgccttgcttcagcgggacagctgggagaacatttttgaactcctcttc
tggggcagatcctctgatggagccaggggaccccaattcatcagccgggactggcatggt
gtgccagggaaagtggacgctgctatgaccggccgcatctacgtcactggctccacatcc
cactctgcccaggccaaaaaacctaagtctaagcgtagaagccgaaaacgctaccgttca
caccgagggcgtggccacagacgcagccacagcttgaattcccgtcgtccatcacgttca
atctggttctcttcgttctccagtgaagagagtgggctaggaacctacaacaactatgat
tatgatatggactggctcgtacctgccacctgcgagcccattcagagtgtctatttcttc
tctggagacaaatactaccgagtcaaccttagaacccagcgagtggactccgtgaatcct
ccctacccacgatccattgctcagtattggctgggctgtccaacctctgagaagtag

DBGET integrated database retrieval system