KEGG   Mus pahari (shrew mouse): 110332320
Entry
110332320         CDS       T05929                                 
Symbol
Nlrp3
Name
(RefSeq) NACHT, LRR and PYD domains-containing protein 3 isoform X1
  KO
K12800  NACHT, LRR and PYD domains-containing protein 3
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04217  Necroptosis
mpah04621  NOD-like receptor signaling pathway
mpah04625  C-type lectin receptor signaling pathway
mpah05132  Salmonella infection
mpah05133  Pertussis
mpah05135  Yersinia infection
mpah05164  Influenza A
mpah05171  Coronavirus disease - COVID-19
mpah05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110332320 (Nlrp3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110332320 (Nlrp3)
   04625 C-type lectin receptor signaling pathway
    110332320 (Nlrp3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110332320 (Nlrp3)
   05164 Influenza A
    110332320 (Nlrp3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110332320 (Nlrp3)
   05135 Yersinia infection
    110332320 (Nlrp3)
   05133 Pertussis
    110332320 (Nlrp3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110332320 (Nlrp3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110332320 (Nlrp3)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mpah04054]
    110332320 (Nlrp3)
Membrane trafficking [BR:mpah04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    110332320 (Nlrp3)
Pattern recognition receptors [BR:mpah04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   110332320 (Nlrp3)
SSDB
Motif
Pfam: NACHT NLRC4_HD2 PYRIN NOD2_WH LRR_6 FISNA LRR_4 AAA_25
Other DBs
NCBI-GeneID: 110332320
NCBI-ProteinID: XP_021069132
Ensembl: MGP_PahariEiJ_G0017569
LinkDB
Position
14:27556631..27587348
AA seq 1033 aa
MTSVRCKLAQYLEDLEDVDLKKFKMHLEDYPPEKGCIPMPRGQMEKADHLDLATLMIDFN
GEEKAWAMAVWIFAAINRRDLWEKAKKDQPEWNDMCASHASMVCQEDSLEEEWMGLLGYL
SRISMCKRKKDYCKMYRRHVRSRFYSIKDRNARLGESVDLNRRYTQLQLVKEHPSKQERE
HELLAIGRTKMRDSPMSSFKLELLFEPEDGHSEPVRTVVFQGAAGIGKTILARKIMLDWA
LGKLFKDKFDYLFFIHCREVSLSTPRSLADLIVSCWPDPNPPVCKILRKPSKILFLMDGF
DELQGAFDEHIGEVCTDWKKAVRGDILLSSLIRKKLLPKASLLITTRPVALEKLQHLLDH
PRHVEILGFSEAKRKEYFFKYFSNELQAREAFRLIQENEVLFTMCFIPLVCWIVCTGLKQ
QMETGKSLAQTSKTTTAVYVFFLSSLLQSRGAIEEHLFSAYLQGLCSLAADGIWNQKILF
EECDLQKHGLQKTDVSAFLRMNVFQKEVDCERFYSFSHMTFQEFFAAMYYLLEEEEEGVT
ARKGPAGCSDLLNRDVKVLLENYGKFEKGYLIFVVRFLFGLVNQERTSYLEKKLSCKISQ
QVRLELLKWIEVKAKAKKLQWQPSQLELFYCLYEMQEEDFVQSAMDYFPKIEINLSTRMD
HVVSSFCIKNCHRVKTLSLGFSHNSPKEEEEEKRGSRPLDQVQCVFPDTHVACSSSLVTC
CLPSSFCRGLFSSLSTNQSLTELDLSDNTLGDPGMRVLCEALQHPGCNIQRLWLGRCGLS
HQCCFDLSSVLSSSQKLVELDLSDNALGDFGVRLLCVGLKHLLCNLQKLWLVSCCLTSAC
CQDLALVLSSNHSLTRLYIGENALGDSGVQVLCEKMKDPQCNLQKLGLVNSGLTSICCSA
LTSVLKTNQNLTHLYLRSNALGDTGLGLLCEGLLHPDCKLQMLELDNCSLTSHCCWNLST
ILTHNHSLRKLNLGNNDLGDLCVVTLCEVLKQQGCLLQSLQLGEMYLNRETKRALEALQE
EKPELTVVFEISW
NT seq 3102 nt   +upstreamnt  +downstreamnt
atgacaagtgtccgttgcaagctggcccagtatctagaggaccttgaagatgtagacctc
aagaaattcaaaatgcatttagaagattacccgccggagaaaggctgcatcccaatgccc
aggggccagatggagaaggcggatcacttagatctagccacactcatgattgacttcaat
ggcgaggagaaggcctgggccatggctgtgtggatctttgccgcgatcaacaggcgagac
ctctgggaaaaagctaagaaggaccagccagagtggaatgacatgtgtgcatctcacgcc
tctatggtgtgccaggaagacagccttgaggaggagtggatgggtttgctggggtacctc
tcccgcatctccatgtgtaaaagaaagaaagattactgtaaaatgtacagaagacatgtg
agaagcaggttctactctatcaaagacaggaacgcacgtctgggtgagagcgtggacctc
aacagacgctacactcagctccaactggtcaaggagcacccaagcaagcaggagagggag
cacgagctcctggccattggccggactaaaatgcgggacagccccatgagttcctttaag
ctggagctgctgtttgagcccgaggacgggcactcggagcctgtgcgcacggtggtgttc
cagggagcagcgggcatcgggaaaaccatcctagccaggaagattatgttggactgggca
ctggggaagctcttcaaagacaaatttgattatttgttctttatccactgtcgagaggtg
agcctcagtacacccaggagtctagcagacctgattgtcagctgctggcctgacccaaac
cctccagtgtgcaagatcctgcgcaagccttccaagatcctcttcctcatggatggcttt
gatgagctgcaaggggcctttgatgagcacattggggaggtctgcaccgactggaagaag
gctgtgcggggagacatcctgctaagcagcctcatccgaaagaaactgctgcccaaggcc
tctctgcttataacgacgaggccggtagccttggagaagctgcagcatctcctggaccac
ccccgccacgtggagatccttggtttctctgaggccaaaaggaaggagtatttctttaag
tatttctccaacgagctgcaggccagggaggccttcaggctgattcaagagaatgaggtt
ctttttaccatgtgcttcattcccctggtctgctggattgtctgcacagggctgaagcag
cagatggagaccgggaagagcctggcccagacctccaagaccaccacggccgtctatgtc
ttcttcctttccagcctgctgcaatcccggggggccattgaggagcacctcttctctgcc
tacctgcaggggctctgttcactggctgcggatggaatttggaaccagaaaatcctattc
gaggagtgtgatctgcagaaacacggcctgcagaagaccgacgtctctgctttcctgagg
atgaacgtgttccagaaggaagtggactgcgagagattctacagcttcagccacatgact
ttccaggagttcttcgccgcgatgtactatttgctggaagaggaggaagagggggtgacc
gcgaggaaggggccggcaggttgttcagatcttctgaacagagacgtgaaggtcctacta
gaaaattatggcaagtttgaaaaaggctatctgatttttgttgtccgattcctctttggc
cttgtaaaccaggagagaacctcctatttggagaagaaattaagctgcaagatctctcag
caagtcagactggagctgctgaagtggattgaagtgaaagccaaggccaagaagctgcag
tggcagcccagccaactggaactgttctactgcctgtacgagatgcaggaggaagacttt
gtgcagagcgccatggactactttcccaaaattgagatcaacctctctaccagaatggat
cacgtggtttcctccttttgtattaagaactgtcatagggtcaaaacactttccctgggg
ttttcccacaactcacccaaggaagaagaagaagagaagagaggaagtcgacccttggat
caagttcagtgtgttttcccagacactcacgttgcctgttcttccagcctggtgacctgc
tgcctcccttctagcttctgccgtggtctcttctcaagtctaagcaccaaccagagcctc
actgagctggacctcagtgacaatactctgggggacccgggcatgagggtgctgtgtgaa
gcactccagcacccaggctgtaacatccagagactgtggttggggcgctgcggactgtcc
catcaatgctgcttcgacctctcctccgtcctgagcagcagccagaagctggtggagctg
gatctcagtgacaatgccctgggggactttggagtcagattgctgtgtgtgggactgaag
catctgctctgcaacctccagaaactctggttggtgagctgctgtctcacatccgcgtgc
tgtcaggatctcgcgttggttctgagttccaaccattctctgaccagactgtacattgga
gaaaatgccttgggagactcaggagtccaagttttgtgtgaaaagatgaaggacccacaa
tgcaacttgcagaagctggggttggtgaattccggccttacttcaatttgttgttcagct
ctgacctctgtgctcaaaaccaaccagaacctcacacacctctacctacgaagcaacgcc
cttggagacacgggactcgggctcctctgtgagggacttctgcacccggactgtaagcta
cagatgctggaattagacaactgcagcctcacctcacactgctgctggaatctctccaca
attctgacccacaaccacagccttcggaagctgaacctgggcaacaacgacctgggcgac
ctgtgcgtggtgaccctctgtgaggtactgaaacagcagggctgcctcctgcagagccta
cagttgggtgaaatgtacttaaatcgtgaaacgaaacgtgccttagaagcactccaggaa
gaaaagcctgagctgactgttgtctttgagatttcctggtag

DBGET integrated database retrieval system