KEGG   Mus pahari (shrew mouse): 110332409
Entry
110332409         CDS       T05929                                 
Symbol
Serpinf2
Name
(RefSeq) alpha-2-antiplasmin isoform X1
  KO
K03983  alpha-2-antiplasmin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110332409 (Serpinf2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110332409 (Serpinf2)
Peptidases and inhibitors [BR:mpah01002]
 Peptidase inhibitors
  Family I4: serpin family
   110332409 (Serpinf2)
SSDB
Motif
Pfam: Serpin DUF2127
Other DBs
NCBI-GeneID: 110332409
NCBI-ProteinID: XP_021069289
Ensembl: MGP_PahariEiJ_G0017874
LinkDB
Position
14:complement(43163622..43171611)
AA seq 496 aa
MNNRNMALLQGLLVLGLSCLQGPCSMFSPVSAVDLPGQQPVSEQAQQKLPPPTLFKLDNQ
ALGDHATLKRSPGDCKSTPTAEDARRLSQAMMAFTTDLFSLVAQTSTSSNLVLSPLSVAL
ALSHLALGAQNQTLQSLQRVLHVNTESCLPHLLSHFYRNLGPGTIRLAARVYLQKGFPIK
DDFLEQSERLFGAKPVKLTGRQEEDLANINQWVKEATEGKIEDFLSELPDNTVLLLLNAI
HFHGFWSTKFDPNLTQKDFFHLDERFTVSVDMMHAVSYPLRWFLLEQPEIQVAHFPLKNN
MSFVVVMPTYFEWNVSEVLANLTWDTLYHPSLRERPTKVRLPKLHLQQRLDLVATLSQLG
LQELFQGPDLRGISEQNLVVSGVQHQSTMELSEAGVEAAAATSVAMNRMSLSSFIVNRPF
LFFIMEDTIGLPLFVGSVRNPNPSALPQLQEQRDSPDNRLVDRNDKADFHGDKTFGPDLK
LAPRLEEDYPQFSSPK
NT seq 1491 nt   +upstreamnt  +downstreamnt
atgaacaacaggaacatggcactgctccaggggctcctggtactcggcttgtcctgtcta
caaggtccctgttccatgttctctcctgtgagcgccgtggatctcccaggacagcagcca
gtgagtgagcaggcccagcagaagctgcccccacctaccctcttcaagttggacaaccag
gctctcggtgaccatgctaccctcaagaggtccccaggagactgcaagagtaccccaact
gcagaggatgctcgcaggctgtctcaggccatgatggcctttactactgacctgttctct
ttggtggcccaaacatccaccagctccaaccttgtcctgtcaccccttagtgtggcccta
gcactctctcacctggcactaggtgctcagaaccaaacactacagagcttgcaacgagtg
ttgcacgtgaacacggaatcctgcctcccgcatctactgagccatttctaccggaaccta
ggcccagggacaatccgactggctgccagagtatacctgcagaaagggtttcccatcaaa
gatgatttcctggagcaatcggaaaggctctttggtgcgaagcccgtgaaactgactgga
aggcaggaggaagacctggcgaacatcaaccaatgggtgaaggaggccacagaggggaag
attgaggatttcctctctgagctgccggataacaccgtgttgcttctcctcaatgccatc
cactttcacggtttctggagtaccaagtttgacccgaacctcacccagaaagatttcttc
cacctggatgagcggttcacggtgtcggtggacatgatgcatgcggtgtcatatcctctt
cgatggttcctgctggagcaacctgagatacaggtggctcatttcccccttaagaacaac
atgagctttgtggtcgtgatgcccacttactttgagtggaacgtgtccgaggtactagcc
aacctgacctgggacactctgtaccatccctcgctgcgggagaggcccaccaaggtgcgg
ctgccaaaactccatctgcaacagcgtctggacctggtggccaccctcagccagctgggc
ctgcaggaattgttccagggcccagacctgcgtgggatctctgagcagaatctggtagtg
tctggcgtgcagcatcagtctaccatggaactcagcgaggctggtgtggaggcggccgca
gctaccagcgtagccatgaatcgaatgtccctctcctccttcattgtgaaccgacccttc
ctcttcttcatcatggaggacaccatcggcttgcccctctttgtgggcagcgtgaggaac
cctaaccccagcgcgctgccccagctccaggaacagcgagattcccctgacaacaggctc
gtagaccggaatgacaaagctgatttccacggagacaagacctttggtcctgacttgaaa
cttgcaccccgcctggaggaagactatccccagtttagctcccccaagtga

DBGET integrated database retrieval system