KEGG   Mus pahari (shrew mouse): 110332555
Entry
110332555         CDS       T05929                                 

Gene name
C1H16orf52
Definition
(RefSeq) uncharacterized protein C16orf52 homolog
  KO
K23663  modulator of smoothened protein
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110332555 (C1H16orf52)
SSDB
Motif
Pfam: Atthog L_HMGIC_fpl Cyt_bd_oxida_I TctB DUF6057 DUF998
Other DBs
NCBI-GeneID: 110332555
NCBI-ProteinID: XP_021069485
Ensembl: MGP_PahariEiJ_G0013608
LinkDB
Position
1
AA seq 167 aa
MDKLTIISGCLFLAADIFAIASIANPDWINTGESAGALTVGLVRQCQTIHGRDRTCIPPR
LPPEWVTTLFFIIMGIISLTVTCGLLVASHWRREATKYARWIAFTGMILFCMAALIFPIG
FYINEVGGQPYKLPNNTVVGSSYVLFVLSIFFTIVGLLFAGKVCLPG
NT seq 504 nt   +upstreamnt  +downstreamnt
atggataaactgaccatcatctcaggatgtctctttctggccgccgatatcttcgccatc
gccagcatcgccaacccggactggatcaacaccggggagtcggcgggagcactcactgtg
ggcctggtgcggcagtgtcagacaatccatggacgagaccggacctgcatccctccgcgg
cttcccccagagtgggtcaccaccctgttttttatcatcatgggaatcatttccttgact
gtcacatgtggtttgctggtggcttcccactggcgaagagaagctacaaaatatgctcga
tggatagcattcactggaatgatccttttctgtatggctgccctaatatttccaatagga
ttttacatcaatgaagtcggaggtcaaccttataagttacccaacaacacagtagttggg
tcatcatatgtactttttgtcttatcgattttcttcacaatagtaggacttctgtttgct
ggcaaagtctgtttaccaggctga

DBGET integrated database retrieval system