KEGG   Mus pahari (shrew mouse): 110332834
Entry
110332834         CDS       T05929                                 
Symbol
Smad2
Name
(RefSeq) mothers against decapentaplegic homolog 2 isoform X1
  KO
K04500  mothers against decapentaplegic homolog 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04110  Cell cycle
mpah04144  Endocytosis
mpah04218  Cellular senescence
mpah04350  TGF-beta signaling pathway
mpah04371  Apelin signaling pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04659  Th17 cell differentiation
mpah04926  Relaxin signaling pathway
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah05142  Chagas disease
mpah05166  Human T-cell leukemia virus 1 infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05210  Colorectal cancer
mpah05212  Pancreatic cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05321  Inflammatory bowel disease
mpah05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110332834 (Smad2)
   04390 Hippo signaling pathway
    110332834 (Smad2)
   04371 Apelin signaling pathway
    110332834 (Smad2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110332834 (Smad2)
  09143 Cell growth and death
   04110 Cell cycle
    110332834 (Smad2)
   04218 Cellular senescence
    110332834 (Smad2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110332834 (Smad2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    110332834 (Smad2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    110332834 (Smad2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110332834 (Smad2)
   05205 Proteoglycans in cancer
    110332834 (Smad2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110332834 (Smad2)
   05212 Pancreatic cancer
    110332834 (Smad2)
   05225 Hepatocellular carcinoma
    110332834 (Smad2)
   05226 Gastric cancer
    110332834 (Smad2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110332834 (Smad2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110332834 (Smad2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    110332834 (Smad2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    110332834 (Smad2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110332834 (Smad2)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 110332834
NCBI-ProteinID: XP_021069801
Ensembl: MGP_PahariEiJ_G0019139
LinkDB
Position
15:69398609..69462479
AA seq 467 aa
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTANTVDQWDTTGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQS
MDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtcgtccatcttgccattcactccgccagtggtgaagagacttctgggatggaaaaaa
tctgccggtgggtctggaggagcaggtggtggagagcagaatggacaggaagaaaagtgg
tgtgaaaaagcagtgaaaagtctggtgaaaaagctaaagaaaacaggacggttagatgag
cttgagaaagccatcaccactcagaattgcaatactaagtgtgtcaccataccaagcact
tgctctgaaatttggggactgagtacagcaaatacggtagatcagtgggacacaacaggc
ctttacagcttctctgaacaaaccaggtctcttgatggccgtcttcaggtttcacaccgc
aaagggttgccacatgttatatattgccggctatggcgctggccggaccttcacagtcat
catgagctcaaggcaatcgaaaactgcgaatatgcttttaatctgaaaaaagatgaagta
tgtgtaaatccttaccactaccagagagttgagacaccagtcttgcctccagtcttagtc
cctcggcacacagagattctaacagaactgccgcctctggatgactatacccactccatt
ccagaaaacacaaatttcccagcaggaattgagccacagagtaattacatcccagaaaca
ccaccacctggatatatcagtgaagatggagaaacaagtgaccaacagttgaaccaaagt
atggacacaggctctccggctgaactgtctcctactactctctctcctgttaatcacagc
ttggatttgcagccagttacttactcggaacctgcgttctggtgttcaatcgcatactat
gaactaaaccagagggttggagaaaccttccatgcgtcacagccctcgctcactgtagac
ggcttcacagacccatcaaactcggagaggttctgcttaggcttgctctccaacgttaac
cgaaatgccactgtagaaatgacaagaaggcatataggaaggggagtgcgcttgtattac
ataggtggggaagtgtttgctgagtgcctaagtgatagtgcaatctttgtgcagagcccc
aactgtaaccagagatacggctggcaccctgcaacagtgtgtaagatcccaccaggctgc
aacctgaagatcttcaacaaccaagaatttgctgctcttctggctcagtctgttaaccag
ggatttgaagccgtttatcagctaacccgaatgtgcaccataagaatgagtttcgtgaag
ggctggggagcagaataccggaggcagacagtcacaagtacaccttgctggattgaactt
catctgaatggccctctgcagtggttggacaaagtattaactcagatgggatccccttca
gtgcgatgctcaagcatgtcgtaa

DBGET integrated database retrieval system