KEGG   Mus pahari (shrew mouse): 110332848
Entry
110332848         CDS       T05929                                 
Symbol
Cdh2
Name
(RefSeq) cadherin-2 isoform X1
  KO
K06736  cadherin 2, type 1, N-cadherin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110332848 (Cdh2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110332848 (Cdh2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mpah03036]
    110332848 (Cdh2)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mpah04515]
    110332848 (Cdh2)
   04090 CD molecules [BR:mpah04090]
    110332848 (Cdh2)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    110332848 (Cdh2)
Cell adhesion molecules [BR:mpah04515]
 Cadherins
  Major cadherins
   110332848 (Cdh2)
CD molecules [BR:mpah04090]
 Proteins
  110332848 (Cdh2)
SSDB
Motif
Pfam: Cadherin Cadherin_pro CADH_Y-type_LIR Cadherin_3 Stevor
Other DBs
NCBI-GeneID: 110332848
NCBI-ProteinID: XP_021069826
Ensembl: MGP_PahariEiJ_G0018757
LinkDB
Position
15:complement(12719701..12938064)
AA seq 906 aa
MCRIAGAPRTLLPLLAALLQASVEASGEIALCKTGFPEDVYSAVLPKDVHEGQPLLNVKF
SNCNRKRKVQYESSEPADFKVDEDGTVYAVRSFPVTAEQAKFLIYAQDKETQEKWQVAVN
LSLEPTLTEEPMKEPHEIEEIVFPRQLAKHTGALQRQKRDWVIPPINLPENSRGPFPQEL
VRIRSDRDKNLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDRELIARFHLRAHAV
DINGNQVENPIDIVINVIDMNDNRPEFLHQVWNGSVPEGSKPGTYVMTVTAIDADDPNAL
NGMLRYRILSQAPSTPSPNMFTINNETGDIITVAAGLDREKVQQYTLIIQATDMEGNPTY
GLSNTATAVITVTDVNDNPPEFTAMTFYGEVPENKVDVIVANLTVTDKDQPHTPAWNAAY
RISGGDPTGRFAILTDPNSNDGLVTVVKPIDFEMNRMFVLTVAAENQVPLAKGIQHPPQS
TATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTLTAQDPDRYMQQNIRYTKLSDP
ANWLKIDPVNGQITTIAVLDRESPNVKNNIYNATFLASDNGIPPMSGTGTLQIYLLDIND
NAPQVLPQEAETCETPEPNSINITALDYDIDPNAGPFAFDLPLSPVTIKRNWTITRLNGD
FAQLNLKIKFLEAGIYEVPIIITDSGNPPKSNISTLRVKVCQCDSNGDCTDVDRIVGAGL
GTGAIIAILLCIIILLILVLMFVVWMKRRDKERQAKQLLIDPEDDVRDNILKYDEEGGGE
EDQDYDLSQLQQPDTVEPDAIKPVGIRRLDERPIHAEPQYPVRSAAPHPGDIGDFINEGL
KAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGDQDYDYLNDWGPRFKKLADM
YGGGDD
NT seq 2721 nt   +upstreamnt  +downstreamnt
atgtgccggatagcgggagcgccgcggaccctgctgccgcttctggcggccttgcttcag
gcatctgtggaggcttctggtgaaattgcattatgcaagactggatttcctgaagatgtt
tacagcgcagtcttaccgaaggatgtgcacgaaggacagccccttctcaatgtgaaattc
agcaactgcaatagaaaaaggaaagttcagtatgaaagcagcgagccagcagatttcaag
gtggatgaggacggcacggtatatgccgtgagaagcttccctgtcactgcagagcaggca
aagttcctgatatatgcccaagacaaagaaacccaggaaaagtggcaggtagctgtaaac
ctgagcctggaaccaaccctgactgaggagcctatgaaggaaccacatgaaattgaagaa
atagtattccctagacagcttgccaagcacactggagctctgcaaaggcagaagagagac
tgggtcatcccgccaatcaacttgccagaaaactccagaggaccctttcctcaagagctt
gtcagaatcaggtctgatagagataaaaacctgtccctgagatacagcgtcactgggcct
ggagccgaccagcctccaactggcatcttcattatcaaccccatctcgggacagctgtcc
gtcacaaagcctctggatcgagagctgatagcccgctttcacttgagggcacatgcggtg
gacatcaatggcaatcaagtggagaaccccattgacattgtcatcaatgttattgacatg
aatgataacagacctgagtttctgcaccaggtttggaatgggtctgttccagagggatca
aagcctgggacgtatgtgatgactgtcactgccattgatgcggatgacccaaatgccctg
aatggaatgctgcggtacaggatcctgtcccaggcgcccagcacaccttcacccaacatg
tttacaatcaacaatgagactggggacatcatcactgtggcagctggtctggatcgagag
aaagtgcaacagtatacgttaataattcaagccacagacatggaaggcaatcccacttat
ggcctttcaaacacagccacggccgtcatcacagtgacagatgtcaatgacaatcctcca
gagtttactgccatgaccttctacggagaagtccctgagaacaaggtggatgtcattgta
gccaacctaactgtcacggacaaagatcagccccacacgccggcctggaatgcggcatac
agaatcagtggtggagaccctacgggaaggtttgccatcctgacagaccccaacagcaat
gatgggctagtcacagtggtaaaaccaattgactttgaaatgaataggatgtttgtcctt
actgttgctgcagaaaaccaagtgccattagctaaggggattcagcacccacctcagtcc
acagcaactgtgtctgtgacagttattgatgtcaatgaaaatccttattttgccccaaat
cctaaaatcattcgccaagaagaaggcctccacgctggtaccatgctgaccacactcact
gctcaggaccctgatcgatatatgcaacagaatatcagatacacaaaactgtctgatcct
gccaattggctgaaaatagatcctgtgaatgggcagatcactactattgctgttttggat
agagaatcgccaaatgtaaaaaacaacatctataatgctaccttccttgcttctgacaat
ggaatccctcctatgagtgggacaggaacactgcaaatctatttacttgatatcaatgac
aacgcccctcaggtgttacctcaagaggccgagacctgtgaaactccagaacccaactca
attaacatcacagcacttgattatgacatagatccaaacgctgggccgttcgcgtttgat
cttcccttatctccagtgactattaaaagaaactggaccatcacccggcttaatggtgat
tttgctcagctcaatttaaagataaagtttttggaagctggtatctatgaagtccccatc
attatcacagattcagggaatccccccaagtccaacatttccaccctgcgtgtgaaagtg
tgccagtgtgactccaatggcgactgtacggacgtcgacaggatcgtgggtgcagggctt
ggcacgggcgccatcatcgctatccttctgtgtatcatcatcctgctgatccttgttctc
atgtttgtggtatggatgaaacgccgggataaagagcgccaagccaagcagcttttaatt
gacccagaagatgatgtaagagataatatattgaaatatgatgaagaaggtggaggagaa
gaagaccaggactacgacttgagccagctgcagcaaccagatactgtggagcctgatgcc
atcaagcccgtgggaatcagacggctagacgagaggcctatccatgctgagccacagtac
ccagtccgatccgcagccccacaccctggggatattggggacttcattaatgagggcctt
aaagctgctgacaacgaccccacggctccgccatatgactccctcttagtctttgactac
gagggcagcggctccaccgctggctccttgagctccctcaactcctccagtagcggcggg
gaccaggactatgactacctgaatgactggggaccccgcttcaagaagctggccgacatg
tacggcggcggtgacgactga

DBGET integrated database retrieval system