KEGG   Mus pahari (shrew mouse): 110333204
Entry
110333204         CDS       T05929                                 

Gene name
Smad4
Definition
(RefSeq) mothers against decapentaplegic homolog 4
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04068  FoxO signaling pathway
mpah04110  Cell cycle
mpah04310  Wnt signaling pathway
mpah04350  TGF-beta signaling pathway
mpah04371  Apelin signaling pathway
mpah04390  Hippo signaling pathway
mpah04520  Adherens junction
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04659  Th17 cell differentiation
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah05161  Hepatitis B
mpah05166  Human T-cell leukemia virus 1 infection
mpah05200  Pathways in cancer
mpah05210  Colorectal cancer
mpah05212  Pancreatic cancer
mpah05220  Chronic myeloid leukemia
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110333204 (Smad4)
   04350 TGF-beta signaling pathway
    110333204 (Smad4)
   04390 Hippo signaling pathway
    110333204 (Smad4)
   04371 Apelin signaling pathway
    110333204 (Smad4)
   04068 FoxO signaling pathway
    110333204 (Smad4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110333204 (Smad4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110333204 (Smad4)
   04550 Signaling pathways regulating pluripotency of stem cells
    110333204 (Smad4)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    110333204 (Smad4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110333204 (Smad4)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110333204 (Smad4)
   05212 Pancreatic cancer
    110333204 (Smad4)
   05225 Hepatocellular carcinoma
    110333204 (Smad4)
   05226 Gastric cancer
    110333204 (Smad4)
   05220 Chronic myeloid leukemia
    110333204 (Smad4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110333204 (Smad4)
   05161 Hepatitis B
    110333204 (Smad4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110333204 (Smad4)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 110333204
NCBI-ProteinID: XP_021070382
Ensembl: MGP_PahariEiJ_G0019120
LinkDB
Position
15
AA seq 551 aa
MDTMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSMLVKDEYVHDFEGQPPLPTEGHSIQT
IQHPPSNRASTETYSAPALLAASESNATSTTNFPNIPVASTSQPASILAGSHSEGLLQIA
SGPQPGQQQNGFTAQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGHY
WPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGDR
FCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRA
PGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPA
ISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLH
TMPIADPQPLD
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggacactatgtctataacaaatacaccaacaagtaatgacgcctgcctgagcattgta
catagtctgatgtgtcatagacagggtggggaaagtgagacgtttgcaaaaagagcaatt
gagagtttggtaaagaagctgaaagagaaaaaagatgaattggattctttaataacagct
ataactacaaacggagctcatcctagcaaatgcgtcaccatacagagaacattggatgga
cgacttcaggtggctggtcggaaaggatttcctcatgtgatctatgcccgtctgtggagg
tggcctgatctacacaagaatgaactaaagcatgttaaatattgtcagtatgcatttgac
ttaaaatgtgatagtgtctgtgtgaatccatatcactatgagcgggttgtctcacctgga
attgatctctcaggattaacactgcagagtaatgctccaagtatgttagtgaaggatgaa
tacgttcatgactttgaaggacagccacccttacccactgaaggacattcaattcaaacc
atccaacacccaccaagtaatcgtgcatcaacggagacatacagcgccccagctctgtta
gccgcgtcagagtctaatgccaccagtaccaccaacttccccaacattcctgtggcttcc
acaagtcagccggccagtattctggcaggcagccatagtgaaggactgttgcagatagct
tcagggcctcagccaggacagcagcagaatggatttactgctcagccagctacttaccat
cataacagcactaccacctggactggaagtaggactgcaccatacacacctaatttgcct
caccaccaaaacggccatcttcagcaccacccgcctatgccgccccaccctggacattac
tggccagttcacaatgagcttgcattccagcctcccatttccaaccatcctgctcctgaa
tattggtgttccattgcttactttgaaatggatgttcaggtaggagagacctttaaggtt
ccttcgagctgccctattgtaactgtggatggatatgtggatccttcgggaggagatcgc
ttttgcctgggtcaactctccaatgtccacaggacagaagctattgagagagcaaggttg
cacataggcaaaggagtgcagttggaatgtaaaggtgaaggtgacgtttgggtcaggtgc
cttagtgaccacgcggtctttgtacagagttactacctggacagagaggccggccgagca
cctggcgacgctgttcataagatctacccaagcgcgtatataaaggtctttgatctgcga
cagtgtcaccggcagatgcagcaacaagcggccaccgcgcaagctgcagctgctgctcag
gcggcggccgtggcagggaacatccctggccctgggtccgtgggtggaatagccccagcc
atcagtctgtctgctgctgctggcattggtgtggacgacctccggcgcttgtgcattctc
aggatgagctttgtgaagggctggggcccagactacccgaggcagagcatcaaggaaacc
ccatgctggattgagattcacctccaccgagctctgcagctcttggatgaagtcctgcac
accatgcccattgcggacccacagcctttagactga

DBGET integrated database retrieval system