KEGG   Mus pahari (shrew mouse): 110334180
Entry
110334180         CDS       T05929                                 
Symbol
Edn1
Name
(RefSeq) endothelin-1
  KO
K16366  endothelin-1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04024  cAMP signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04080  Neuroactive ligand-receptor interaction
mpah04270  Vascular smooth muscle contraction
mpah04668  TNF signaling pathway
mpah04916  Melanogenesis
mpah04924  Renin secretion
mpah04926  Relaxin signaling pathway
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah05200  Pathways in cancer
mpah05410  Hypertrophic cardiomyopathy
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    110334180 (Edn1)
   04066 HIF-1 signaling pathway
    110334180 (Edn1)
   04024 cAMP signaling pathway
    110334180 (Edn1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110334180 (Edn1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    110334180 (Edn1)
   04916 Melanogenesis
    110334180 (Edn1)
   04924 Renin secretion
    110334180 (Edn1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110334180 (Edn1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110334180 (Edn1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110334180 (Edn1)
   05410 Hypertrophic cardiomyopathy
    110334180 (Edn1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110334180 (Edn1)
SSDB
Motif
Pfam: Endothelin
Other DBs
NCBI-GeneID: 110334180
NCBI-ProteinID: XP_021071702
Ensembl: MGP_PahariEiJ_G0019532
LinkDB
Position
16:45226220..45232588
AA seq 202 aa
MDYFPVIFSLLLVTSQGAPETAVLGAELSTGAENRVQSPAPSTPWRPRRSKRCSCSSLMD
KECVYFCHLDIIWVNTPERVVPYGLGSSSRSRRSLKDLLPTKATDQAIRCQCAHQKDKKC
WNFCQAGKELRAQSTMQKGLKDSKKGKPCSKLGKKCIYQQLVEGRKLRRLEAISNSIRAS
FRVAKLKAELYRDQKLTHNRAH
NT seq 609 nt   +upstreamnt  +downstreamnt
atggattattttcccgtgatcttctctctgctgttggtgacttcccaaggagctccagaa
acagctgtcttgggagctgagctcagcaccggagctgagaacagagtgcagagccccgct
cccagcacaccctggagaccccgaaggtccaagcgctgttcctgttcttccttgatggac
aaggagtgtgtctacttctgccacctggacatcatctgggtcaacactcccgagcgtgtc
gtcccgtatggactgggaagctcttccaggtccaggcgttccttgaaagacttacttccc
acaaaggccacagaccaggcgattagatgtcagtgcgctcaccaaaaagacaagaagtgc
tggaatttctgccaagcaggaaaagaactcagggcccaaagtaccatgcagaagggctta
aaagactccaagaaaggaaaaccctgttccaagttgggaaagaagtgtatctatcagcag
ctggtggaaggaaggaaactaagaaggttggaggccatcagcaacagcatcagggcatct
tttcgtgttgcgaagttgaaagctgagctctatagagaccagaagttgacacacaaccga
gcacattga

DBGET integrated database retrieval system