KEGG   Mus pahari (shrew mouse): 110334495
Entry
110334495         CDS       T05929                                 

Symbol
Mapk11
Name
(RefSeq) mitogen-activated protein kinase 11 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01522  Endocrine resistance
mpah04010  MAPK signaling pathway
mpah04015  Rap1 signaling pathway
mpah04068  FoxO signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04114  Oocyte meiosis
mpah04218  Cellular senescence
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04370  VEGF signaling pathway
mpah04380  Osteoclast differentiation
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04611  Platelet activation
mpah04613  Neutrophil extracellular trap formation
mpah04620  Toll-like receptor signaling pathway
mpah04621  NOD-like receptor signaling pathway
mpah04622  RIG-I-like receptor signaling pathway
mpah04625  C-type lectin receptor signaling pathway
mpah04657  IL-17 signaling pathway
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04660  T cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04668  TNF signaling pathway
mpah04670  Leukocyte transendothelial migration
mpah04714  Thermogenesis
mpah04722  Neurotrophin signaling pathway
mpah04723  Retrograde endocannabinoid signaling
mpah04728  Dopaminergic synapse
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04912  GnRH signaling pathway
mpah04914  Progesterone-mediated oocyte maturation
mpah04917  Prolactin signaling pathway
mpah04926  Relaxin signaling pathway
mpah04932  Non-alcoholic fatty liver disease
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04935  Growth hormone synthesis, secretion and action
mpah04936  Alcoholic liver disease
mpah05014  Amyotrophic lateral sclerosis
mpah05020  Prion disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05132  Salmonella infection
mpah05133  Pertussis
mpah05135  Yersinia infection
mpah05140  Leishmaniasis
mpah05142  Chagas disease
mpah05145  Toxoplasmosis
mpah05152  Tuberculosis
mpah05161  Hepatitis B
mpah05163  Human cytomegalovirus infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05205  Proteoglycans in cancer
mpah05208  Chemical carcinogenesis - reactive oxygen species
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05415  Diabetic cardiomyopathy
mpah05417  Lipid and atherosclerosis
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110334495 (Mapk11)
   04015 Rap1 signaling pathway
    110334495 (Mapk11)
   04370 VEGF signaling pathway
    110334495 (Mapk11)
   04668 TNF signaling pathway
    110334495 (Mapk11)
   04068 FoxO signaling pathway
    110334495 (Mapk11)
   04071 Sphingolipid signaling pathway
    110334495 (Mapk11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110334495 (Mapk11)
   04218 Cellular senescence
    110334495 (Mapk11)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110334495 (Mapk11)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110334495 (Mapk11)
   04613 Neutrophil extracellular trap formation
    110334495 (Mapk11)
   04620 Toll-like receptor signaling pathway
    110334495 (Mapk11)
   04621 NOD-like receptor signaling pathway
    110334495 (Mapk11)
   04622 RIG-I-like receptor signaling pathway
    110334495 (Mapk11)
   04625 C-type lectin receptor signaling pathway
    110334495 (Mapk11)
   04660 T cell receptor signaling pathway
    110334495 (Mapk11)
   04658 Th1 and Th2 cell differentiation
    110334495 (Mapk11)
   04659 Th17 cell differentiation
    110334495 (Mapk11)
   04657 IL-17 signaling pathway
    110334495 (Mapk11)
   04664 Fc epsilon RI signaling pathway
    110334495 (Mapk11)
   04670 Leukocyte transendothelial migration
    110334495 (Mapk11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    110334495 (Mapk11)
   04914 Progesterone-mediated oocyte maturation
    110334495 (Mapk11)
   04917 Prolactin signaling pathway
    110334495 (Mapk11)
   04926 Relaxin signaling pathway
    110334495 (Mapk11)
   04935 Growth hormone synthesis, secretion and action
    110334495 (Mapk11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110334495 (Mapk11)
  09156 Nervous system
   04728 Dopaminergic synapse
    110334495 (Mapk11)
   04723 Retrograde endocannabinoid signaling
    110334495 (Mapk11)
   04722 Neurotrophin signaling pathway
    110334495 (Mapk11)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110334495 (Mapk11)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110334495 (Mapk11)
  09159 Environmental adaptation
   04714 Thermogenesis
    110334495 (Mapk11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110334495 (Mapk11)
   05208 Chemical carcinogenesis - reactive oxygen species
    110334495 (Mapk11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110334495 (Mapk11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110334495 (Mapk11)
   05161 Hepatitis B
    110334495 (Mapk11)
   05171 Coronavirus disease - COVID-19
    110334495 (Mapk11)
   05163 Human cytomegalovirus infection
    110334495 (Mapk11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110334495 (Mapk11)
   05169 Epstein-Barr virus infection
    110334495 (Mapk11)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110334495 (Mapk11)
   05135 Yersinia infection
    110334495 (Mapk11)
   05133 Pertussis
    110334495 (Mapk11)
   05152 Tuberculosis
    110334495 (Mapk11)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110334495 (Mapk11)
   05140 Leishmaniasis
    110334495 (Mapk11)
   05142 Chagas disease
    110334495 (Mapk11)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    110334495 (Mapk11)
   05020 Prion disease
    110334495 (Mapk11)
   05022 Pathways of neurodegeneration - multiple diseases
    110334495 (Mapk11)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110334495 (Mapk11)
   05418 Fluid shear stress and atherosclerosis
    110334495 (Mapk11)
   05415 Diabetic cardiomyopathy
    110334495 (Mapk11)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    110334495 (Mapk11)
   04932 Non-alcoholic fatty liver disease
    110334495 (Mapk11)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110334495 (Mapk11)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110334495 (Mapk11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110334495 (Mapk11)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     110334495 (Mapk11)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   110334495 (Mapk11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kdo APH RIO1 Cas_CT1975 Kinase-like
Other DBs
NCBI-GeneID: 110334495
NCBI-ProteinID: XP_021071887
Ensembl: MGP_PahariEiJ_G0020160
LinkDB
Position
17
AA seq 364 aa
MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ
SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ
ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGNDYIDQLKRIMEVVG
TPSPEVLAKISSEHARTYIQSLPPMPQKDLRSVFHGANPLAVDLLGRMLVLDSDQRVSAA
EALAHAYFSQYHDPNDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPLEPSQLPGTH
EIEQ
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgtcgggtccgcgagcgggattctaccggcaagagctgaacaaaacagtatgggaggtg
ccacagcggctgcagggcctacgcccggtgggctccggcgcctacggctccgtctgctcg
gcctacgacgcgcggctgcgccagaaggtggctgtgaagaagctgtctcgccctttccaa
tcgctgatccacgcgaggaggacataccgtgagctacgcctactcaaacatctgaagcat
gagaacgtcataggacttttggacgtcttcacgccggccacatccatcgaggatttcagc
gaagtgtacctcgtgacgactctgatgggcgccgacctgaataacatcgtcaagtgtcag
gcactgagcgatgagcatgttcaattccttgtctaccagctgctgcgtgggctgaagtat
atccactcggcgggcatcatccaccgggacctgaagcccagcaatgtagcggtgaacgag
gactgcgagctgaggatcctggactttgggctggcacgccaagctgatgaggagatgacc
ggatatgtggccacacggtggtaccgggcaccagagatcatgctgaactggatgcactac
aaccagacagtggacatctggtctgtgggctgcatcatggctgaactgctgcaaggaaag
gccctctttcctggaaacgactacatcgaccagctgaagcgaatcatggaggtggtgggc
acacccagccctgaggttctggcaaagatatcctcggagcatgcccggacgtacatccag
tctctgccccccatgccccagaaggacctccgcagtgtctttcatggagccaaccctctg
gctgtagacctccttggaagaatgctggtactagacagtgaccagagggtcagtgcggcc
gaagccttggcccatgcatacttcagccagtaccatgaccccaacgatgagccagaagcg
gagccctatgatgaaagtgttgaggccaaggagcgcacgctggaggagtggaaggagctt
acttaccaggaagtccttagcttcaagcccttggaaccgtcacagctccctggcacccac
gaaattgagcagtga

KEGG   Mus pahari (shrew mouse): 110334829
Entry
110334829         CDS       T05929                                 

Symbol
Mapk12
Name
(RefSeq) mitogen-activated protein kinase 12 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01522  Endocrine resistance
mpah04010  MAPK signaling pathway
mpah04015  Rap1 signaling pathway
mpah04068  FoxO signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04114  Oocyte meiosis
mpah04218  Cellular senescence
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04370  VEGF signaling pathway
mpah04380  Osteoclast differentiation
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04611  Platelet activation
mpah04613  Neutrophil extracellular trap formation
mpah04620  Toll-like receptor signaling pathway
mpah04621  NOD-like receptor signaling pathway
mpah04622  RIG-I-like receptor signaling pathway
mpah04625  C-type lectin receptor signaling pathway
mpah04657  IL-17 signaling pathway
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04660  T cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04668  TNF signaling pathway
mpah04670  Leukocyte transendothelial migration
mpah04714  Thermogenesis
mpah04722  Neurotrophin signaling pathway
mpah04723  Retrograde endocannabinoid signaling
mpah04728  Dopaminergic synapse
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04912  GnRH signaling pathway
mpah04914  Progesterone-mediated oocyte maturation
mpah04917  Prolactin signaling pathway
mpah04926  Relaxin signaling pathway
mpah04932  Non-alcoholic fatty liver disease
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04935  Growth hormone synthesis, secretion and action
mpah04936  Alcoholic liver disease
mpah05014  Amyotrophic lateral sclerosis
mpah05020  Prion disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05132  Salmonella infection
mpah05133  Pertussis
mpah05135  Yersinia infection
mpah05140  Leishmaniasis
mpah05142  Chagas disease
mpah05145  Toxoplasmosis
mpah05152  Tuberculosis
mpah05161  Hepatitis B
mpah05163  Human cytomegalovirus infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05205  Proteoglycans in cancer
mpah05208  Chemical carcinogenesis - reactive oxygen species
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05415  Diabetic cardiomyopathy
mpah05417  Lipid and atherosclerosis
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110334829 (Mapk12)
   04015 Rap1 signaling pathway
    110334829 (Mapk12)
   04370 VEGF signaling pathway
    110334829 (Mapk12)
   04668 TNF signaling pathway
    110334829 (Mapk12)
   04068 FoxO signaling pathway
    110334829 (Mapk12)
   04071 Sphingolipid signaling pathway
    110334829 (Mapk12)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110334829 (Mapk12)
   04218 Cellular senescence
    110334829 (Mapk12)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110334829 (Mapk12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110334829 (Mapk12)
   04613 Neutrophil extracellular trap formation
    110334829 (Mapk12)
   04620 Toll-like receptor signaling pathway
    110334829 (Mapk12)
   04621 NOD-like receptor signaling pathway
    110334829 (Mapk12)
   04622 RIG-I-like receptor signaling pathway
    110334829 (Mapk12)
   04625 C-type lectin receptor signaling pathway
    110334829 (Mapk12)
   04660 T cell receptor signaling pathway
    110334829 (Mapk12)
   04658 Th1 and Th2 cell differentiation
    110334829 (Mapk12)
   04659 Th17 cell differentiation
    110334829 (Mapk12)
   04657 IL-17 signaling pathway
    110334829 (Mapk12)
   04664 Fc epsilon RI signaling pathway
    110334829 (Mapk12)
   04670 Leukocyte transendothelial migration
    110334829 (Mapk12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    110334829 (Mapk12)
   04914 Progesterone-mediated oocyte maturation
    110334829 (Mapk12)
   04917 Prolactin signaling pathway
    110334829 (Mapk12)
   04926 Relaxin signaling pathway
    110334829 (Mapk12)
   04935 Growth hormone synthesis, secretion and action
    110334829 (Mapk12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110334829 (Mapk12)
  09156 Nervous system
   04728 Dopaminergic synapse
    110334829 (Mapk12)
   04723 Retrograde endocannabinoid signaling
    110334829 (Mapk12)
   04722 Neurotrophin signaling pathway
    110334829 (Mapk12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110334829 (Mapk12)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110334829 (Mapk12)
  09159 Environmental adaptation
   04714 Thermogenesis
    110334829 (Mapk12)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110334829 (Mapk12)
   05208 Chemical carcinogenesis - reactive oxygen species
    110334829 (Mapk12)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110334829 (Mapk12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110334829 (Mapk12)
   05161 Hepatitis B
    110334829 (Mapk12)
   05171 Coronavirus disease - COVID-19
    110334829 (Mapk12)
   05163 Human cytomegalovirus infection
    110334829 (Mapk12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110334829 (Mapk12)
   05169 Epstein-Barr virus infection
    110334829 (Mapk12)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110334829 (Mapk12)
   05135 Yersinia infection
    110334829 (Mapk12)
   05133 Pertussis
    110334829 (Mapk12)
   05152 Tuberculosis
    110334829 (Mapk12)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110334829 (Mapk12)
   05140 Leishmaniasis
    110334829 (Mapk12)
   05142 Chagas disease
    110334829 (Mapk12)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    110334829 (Mapk12)
   05020 Prion disease
    110334829 (Mapk12)
   05022 Pathways of neurodegeneration - multiple diseases
    110334829 (Mapk12)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110334829 (Mapk12)
   05418 Fluid shear stress and atherosclerosis
    110334829 (Mapk12)
   05415 Diabetic cardiomyopathy
    110334829 (Mapk12)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    110334829 (Mapk12)
   04932 Non-alcoholic fatty liver disease
    110334829 (Mapk12)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110334829 (Mapk12)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110334829 (Mapk12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110334829 (Mapk12)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     110334829 (Mapk12)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   110334829 (Mapk12)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Kdo Kinase-like Haspin_kinase UvrD_C
Other DBs
NCBI-GeneID: 110334829
NCBI-ProteinID: XP_021072454
Ensembl: MGP_PahariEiJ_G0020159
LinkDB
Position
17
AA seq 367 aa
MSSPPPARKGFYRQEVTKTAWEVRAVYQDLQPVGSGAYGAVCSAVDSRTGNKVAIKKLYR
PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDESLDDFTDFYLVMPFMGTDLGKLM
KHETLSEDRIQFLVYQMLKGLKYIHAAGVIHRDLKPGNLAVNEDCELKILDFGLARQADS
EMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKILFKGNDHLDQLKEIMK
VTGTPPPEFVQKLQSAEAKNYMEGLPELEKKDFASVLTNASPQAVSLLEKMLVLDAEQRV
TAAEALAHPYFESLRDTEDEPKAQKYDDSFDDVDRTLEEWKRVTYKEVLSFKPPRQLGAR
VPKETAL
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgagctccccgccacccgcccgcaagggcttttaccgccaggaggtgaccaaaacggcc
tgggaggtgcgcgccgtgtaccaggacctgcagcccgttggctctggtgcctatggtgca
gtgtgctctgcagtagacagccgcactggcaacaaggtggccatcaagaagttgtaccgg
cccttccagtcggagctgtttgccaagcgcgcctacagagagttgcgcctcctcaaacac
atgcgccacgagaacgtcattgggctactggatgtgttcactcctgatgagtctttggac
gacttcacagacttctacctggtgatgccattcatgggcactgatctgggcaaactcatg
aagcatgagactctgagtgaagacagaatccagtttcttgtgtatcagatgctgaaggga
ctgaagtatatccatgctgctggtgtcatccacagagacttgaagcctggcaacctggct
gtgaatgaggactgtgagctgaagatcctagactttggccttgccaggcaggcagacagt
gaaatgacaggatatgtggtaacccggtggtatcgggcaccggaggtcatcttgaattgg
atgcgctacacgcagacagtggacatttggtctgttggctgcatcatggcggagatgatt
actggaaagatcctgttcaaaggcaatgaccatctggaccagctgaaggagatcatgaag
gtcacagggacaccccctcctgagtttgtacagaaactacagagtgcagaggccaagaac
tacatggaaggcctccctgagttagaaaagaaggattttgcctctgtcctgaccaacgca
agccctcaggctgtgagtctcctggaaaagatgctggtgctggatgcggaacagcgggtg
acagcagccgaggctttagcccatccatacttcgagtcccttcgggacactgaggatgaa
cccaaggcccagaaatatgacgactcctttgatgatgtagaccgcacccttgaggaatgg
aagcgtgttacttacaaggaagttctcagcttcaagcctcccaggcagctaggagccaga
gttccaaaggagacggctctgtga

KEGG   Mus pahari (shrew mouse): 110337896
Entry
110337896         CDS       T05929                                 

Symbol
Mapk13
Name
(RefSeq) mitogen-activated protein kinase 13
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01522  Endocrine resistance
mpah04010  MAPK signaling pathway
mpah04015  Rap1 signaling pathway
mpah04068  FoxO signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04114  Oocyte meiosis
mpah04218  Cellular senescence
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04370  VEGF signaling pathway
mpah04380  Osteoclast differentiation
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04611  Platelet activation
mpah04613  Neutrophil extracellular trap formation
mpah04620  Toll-like receptor signaling pathway
mpah04621  NOD-like receptor signaling pathway
mpah04622  RIG-I-like receptor signaling pathway
mpah04625  C-type lectin receptor signaling pathway
mpah04657  IL-17 signaling pathway
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04660  T cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04668  TNF signaling pathway
mpah04670  Leukocyte transendothelial migration
mpah04714  Thermogenesis
mpah04722  Neurotrophin signaling pathway
mpah04723  Retrograde endocannabinoid signaling
mpah04728  Dopaminergic synapse
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04912  GnRH signaling pathway
mpah04914  Progesterone-mediated oocyte maturation
mpah04917  Prolactin signaling pathway
mpah04926  Relaxin signaling pathway
mpah04932  Non-alcoholic fatty liver disease
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04935  Growth hormone synthesis, secretion and action
mpah04936  Alcoholic liver disease
mpah05014  Amyotrophic lateral sclerosis
mpah05020  Prion disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05132  Salmonella infection
mpah05133  Pertussis
mpah05135  Yersinia infection
mpah05140  Leishmaniasis
mpah05142  Chagas disease
mpah05145  Toxoplasmosis
mpah05152  Tuberculosis
mpah05161  Hepatitis B
mpah05163  Human cytomegalovirus infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05205  Proteoglycans in cancer
mpah05208  Chemical carcinogenesis - reactive oxygen species
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05415  Diabetic cardiomyopathy
mpah05417  Lipid and atherosclerosis
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110337896 (Mapk13)
   04015 Rap1 signaling pathway
    110337896 (Mapk13)
   04370 VEGF signaling pathway
    110337896 (Mapk13)
   04668 TNF signaling pathway
    110337896 (Mapk13)
   04068 FoxO signaling pathway
    110337896 (Mapk13)
   04071 Sphingolipid signaling pathway
    110337896 (Mapk13)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110337896 (Mapk13)
   04218 Cellular senescence
    110337896 (Mapk13)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110337896 (Mapk13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110337896 (Mapk13)
   04613 Neutrophil extracellular trap formation
    110337896 (Mapk13)
   04620 Toll-like receptor signaling pathway
    110337896 (Mapk13)
   04621 NOD-like receptor signaling pathway
    110337896 (Mapk13)
   04622 RIG-I-like receptor signaling pathway
    110337896 (Mapk13)
   04625 C-type lectin receptor signaling pathway
    110337896 (Mapk13)
   04660 T cell receptor signaling pathway
    110337896 (Mapk13)
   04658 Th1 and Th2 cell differentiation
    110337896 (Mapk13)
   04659 Th17 cell differentiation
    110337896 (Mapk13)
   04657 IL-17 signaling pathway
    110337896 (Mapk13)
   04664 Fc epsilon RI signaling pathway
    110337896 (Mapk13)
   04670 Leukocyte transendothelial migration
    110337896 (Mapk13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    110337896 (Mapk13)
   04914 Progesterone-mediated oocyte maturation
    110337896 (Mapk13)
   04917 Prolactin signaling pathway
    110337896 (Mapk13)
   04926 Relaxin signaling pathway
    110337896 (Mapk13)
   04935 Growth hormone synthesis, secretion and action
    110337896 (Mapk13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110337896 (Mapk13)
  09156 Nervous system
   04728 Dopaminergic synapse
    110337896 (Mapk13)
   04723 Retrograde endocannabinoid signaling
    110337896 (Mapk13)
   04722 Neurotrophin signaling pathway
    110337896 (Mapk13)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110337896 (Mapk13)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110337896 (Mapk13)
  09159 Environmental adaptation
   04714 Thermogenesis
    110337896 (Mapk13)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110337896 (Mapk13)
   05208 Chemical carcinogenesis - reactive oxygen species
    110337896 (Mapk13)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110337896 (Mapk13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110337896 (Mapk13)
   05161 Hepatitis B
    110337896 (Mapk13)
   05171 Coronavirus disease - COVID-19
    110337896 (Mapk13)
   05163 Human cytomegalovirus infection
    110337896 (Mapk13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110337896 (Mapk13)
   05169 Epstein-Barr virus infection
    110337896 (Mapk13)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110337896 (Mapk13)
   05135 Yersinia infection
    110337896 (Mapk13)
   05133 Pertussis
    110337896 (Mapk13)
   05152 Tuberculosis
    110337896 (Mapk13)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110337896 (Mapk13)
   05140 Leishmaniasis
    110337896 (Mapk13)
   05142 Chagas disease
    110337896 (Mapk13)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    110337896 (Mapk13)
   05020 Prion disease
    110337896 (Mapk13)
   05022 Pathways of neurodegeneration - multiple diseases
    110337896 (Mapk13)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110337896 (Mapk13)
   05418 Fluid shear stress and atherosclerosis
    110337896 (Mapk13)
   05415 Diabetic cardiomyopathy
    110337896 (Mapk13)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    110337896 (Mapk13)
   04932 Non-alcoholic fatty liver disease
    110337896 (Mapk13)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110337896 (Mapk13)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110337896 (Mapk13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110337896 (Mapk13)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     110337896 (Mapk13)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   110337896 (Mapk13)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Kinase-like Kdo FTA2 SSXRD
Other DBs
NCBI-GeneID: 110337896
NCBI-ProteinID: XP_021076631
Ensembl: MGP_PahariEiJ_G0023647
LinkDB
Position
21
AA seq 366 aa
MSLTRKRGFYKQDINKTAWELPKTYLAPAHVGSGAYGAVCSAIDKRTGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMHHENVIGLLDVFTPASSLRNFHDFYLVMPFMQTDLQKIMGM
EFSEDKVQCLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHTDAEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPGAEFVQKLKDKAAKSYIQSLPQSPKKDFTQLFPRASPQAADLLDKMLELDVDKRLTAA
QALAHPFFEPFRDPEEETEAQQPFDDALEHEKLSVDEWKQHIYKEISNFSPIARKDSRRR
SGMKLQ
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgagcctcactcggaaaaggggcttctacaagcaggacatcaacaagactgcctgggag
ctacccaagacctacctggcgcccgcgcacgtcggcagcggggcctatggcgcggtgtgc
tcggccatcgacaagcggacaggggagaaggtggccatcaagaaactgagccggcccttc
cagtcggagatctttgccaagcgcgcttaccgcgagcttctgctcctgaagcacatgcac
catgagaacgtcattgggcttctggatgtcttcacccctgcgtcttcccttcggaacttc
catgatttctacctggtgatgcccttcatgcagacagacctgcagaagatcatggggatg
gaattcagcgaggataaggtccagtgcttggtataccagatgctcaaaggtctaaagtac
atccactccgctggtgtcgtccatagggacctgaagccgggcaacctggccgtgaatgaa
gactgtgagctgaagattctggactttgggctggcccgccacactgacgctgagatgacg
ggctatgtggtgacccgctggtaccgggcccctgaggtgatcctcagctggatgcattac
aaccagacagtggacatctggtctgttggttgcatcatggcagaaatgctgaccggaaag
acactcttcaagggcaaggactacctggaccagctgacccagatcctgaaagtgactggg
gtgccgggtgccgagttcgtgcagaaactgaaagacaaggcggccaaatcctatattcag
tccctaccccagagtcccaagaaggatttcacacagctcttcccacgcgccagcccacaa
gctgcagacctgctggacaagatgctggagctggatgtggacaagcgtctgaccgctgct
caggcattggctcaccccttctttgaacccttccgggaccctgaggaggagacagaggcc
cagcaaccttttgacgatgccttagaacatgagaaactcagcgtggacgaatggaaacaa
cacatctacaaagagatctcaaacttcagtcccatagcccggaaggactcacggcgacga
agtggcatgaagctgcagtga

KEGG   Mus pahari (shrew mouse): 110337946
Entry
110337946         CDS       T05929                                 

Symbol
Mapk14
Name
(RefSeq) mitogen-activated protein kinase 14 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01522  Endocrine resistance
mpah04010  MAPK signaling pathway
mpah04015  Rap1 signaling pathway
mpah04068  FoxO signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04114  Oocyte meiosis
mpah04218  Cellular senescence
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04370  VEGF signaling pathway
mpah04380  Osteoclast differentiation
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04611  Platelet activation
mpah04613  Neutrophil extracellular trap formation
mpah04620  Toll-like receptor signaling pathway
mpah04621  NOD-like receptor signaling pathway
mpah04622  RIG-I-like receptor signaling pathway
mpah04625  C-type lectin receptor signaling pathway
mpah04657  IL-17 signaling pathway
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04660  T cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04668  TNF signaling pathway
mpah04670  Leukocyte transendothelial migration
mpah04714  Thermogenesis
mpah04722  Neurotrophin signaling pathway
mpah04723  Retrograde endocannabinoid signaling
mpah04728  Dopaminergic synapse
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04912  GnRH signaling pathway
mpah04914  Progesterone-mediated oocyte maturation
mpah04917  Prolactin signaling pathway
mpah04926  Relaxin signaling pathway
mpah04932  Non-alcoholic fatty liver disease
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04935  Growth hormone synthesis, secretion and action
mpah04936  Alcoholic liver disease
mpah05014  Amyotrophic lateral sclerosis
mpah05020  Prion disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05132  Salmonella infection
mpah05133  Pertussis
mpah05135  Yersinia infection
mpah05140  Leishmaniasis
mpah05142  Chagas disease
mpah05145  Toxoplasmosis
mpah05152  Tuberculosis
mpah05161  Hepatitis B
mpah05163  Human cytomegalovirus infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05205  Proteoglycans in cancer
mpah05208  Chemical carcinogenesis - reactive oxygen species
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05415  Diabetic cardiomyopathy
mpah05417  Lipid and atherosclerosis
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110337946 (Mapk14)
   04015 Rap1 signaling pathway
    110337946 (Mapk14)
   04370 VEGF signaling pathway
    110337946 (Mapk14)
   04668 TNF signaling pathway
    110337946 (Mapk14)
   04068 FoxO signaling pathway
    110337946 (Mapk14)
   04071 Sphingolipid signaling pathway
    110337946 (Mapk14)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110337946 (Mapk14)
   04218 Cellular senescence
    110337946 (Mapk14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110337946 (Mapk14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110337946 (Mapk14)
   04613 Neutrophil extracellular trap formation
    110337946 (Mapk14)
   04620 Toll-like receptor signaling pathway
    110337946 (Mapk14)
   04621 NOD-like receptor signaling pathway
    110337946 (Mapk14)
   04622 RIG-I-like receptor signaling pathway
    110337946 (Mapk14)
   04625 C-type lectin receptor signaling pathway
    110337946 (Mapk14)
   04660 T cell receptor signaling pathway
    110337946 (Mapk14)
   04658 Th1 and Th2 cell differentiation
    110337946 (Mapk14)
   04659 Th17 cell differentiation
    110337946 (Mapk14)
   04657 IL-17 signaling pathway
    110337946 (Mapk14)
   04664 Fc epsilon RI signaling pathway
    110337946 (Mapk14)
   04670 Leukocyte transendothelial migration
    110337946 (Mapk14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    110337946 (Mapk14)
   04914 Progesterone-mediated oocyte maturation
    110337946 (Mapk14)
   04917 Prolactin signaling pathway
    110337946 (Mapk14)
   04926 Relaxin signaling pathway
    110337946 (Mapk14)
   04935 Growth hormone synthesis, secretion and action
    110337946 (Mapk14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110337946 (Mapk14)
  09156 Nervous system
   04728 Dopaminergic synapse
    110337946 (Mapk14)
   04723 Retrograde endocannabinoid signaling
    110337946 (Mapk14)
   04722 Neurotrophin signaling pathway
    110337946 (Mapk14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110337946 (Mapk14)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110337946 (Mapk14)
  09159 Environmental adaptation
   04714 Thermogenesis
    110337946 (Mapk14)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110337946 (Mapk14)
   05208 Chemical carcinogenesis - reactive oxygen species
    110337946 (Mapk14)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110337946 (Mapk14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110337946 (Mapk14)
   05161 Hepatitis B
    110337946 (Mapk14)
   05171 Coronavirus disease - COVID-19
    110337946 (Mapk14)
   05163 Human cytomegalovirus infection
    110337946 (Mapk14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110337946 (Mapk14)
   05169 Epstein-Barr virus infection
    110337946 (Mapk14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110337946 (Mapk14)
   05135 Yersinia infection
    110337946 (Mapk14)
   05133 Pertussis
    110337946 (Mapk14)
   05152 Tuberculosis
    110337946 (Mapk14)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110337946 (Mapk14)
   05140 Leishmaniasis
    110337946 (Mapk14)
   05142 Chagas disease
    110337946 (Mapk14)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    110337946 (Mapk14)
   05020 Prion disease
    110337946 (Mapk14)
   05022 Pathways of neurodegeneration - multiple diseases
    110337946 (Mapk14)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110337946 (Mapk14)
   05418 Fluid shear stress and atherosclerosis
    110337946 (Mapk14)
   05415 Diabetic cardiomyopathy
    110337946 (Mapk14)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    110337946 (Mapk14)
   04932 Non-alcoholic fatty liver disease
    110337946 (Mapk14)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110337946 (Mapk14)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110337946 (Mapk14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110337946 (Mapk14)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     110337946 (Mapk14)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   110337946 (Mapk14)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kdo APH NAD_binding_8 Kinase-like
Other DBs
NCBI-GeneID: 110337946
NCBI-ProteinID: XP_021076734
Ensembl: MGP_PahariEiJ_G0023646
LinkDB
Position
21
AA seq 360 aa
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtcgcaggagaggcccacgttctaccggcaggagctgaacaagaccatctgggaggtg
cccgagcgataccagaacctgtccccggtgggctccggcgcctatggctcggtgtgtgct
gcttttgatacaaagacggggcatcgtgtggcagttaagaagctgtcgagaccatttcag
tccatcattcacgccaaaaggacctaccgagagctgcgcctgctgaagcacatgaaacac
gagaatgtgattggtctgttggacgtgtttacacccgcaaggtccctggaggaattcaac
gacgtgtacctggtgacccatctcatgggggcggacctgaacaacatcgtgaagtgtcag
aagttgaccgatgaccacgttcagtttctcatctaccagatccttcgagggctgaagtat
atacattcggctgacataattcacagggacctaaagcccagcaacctagctgtgaacgaa
gactgtgaactcaagattctggattttgggctggctcggcacactgatgatgagatgaca
ggctacgtggctaccaggtggtaccgagcccctgagatcatgctgaattggatgcactac
aaccagacagtggatatttggtccgtgggctgcatcatggctgagctgttaaccggaaga
acgttgtttcctggtacagaccatattgatcagttgaagctcattttaagactcgttgga
accccaggggctgagcttctgaagaaaatctcctcagagtctgcaagaaactacattcag
tctctggcccagatgccgaagatgaacttcgcaaatgtatttattggtgccaatcccctg
gctgtcgacctgctggagaagatgctcgttttggactcagataagaggatcacagcagcc
caagctcttgcgcatgcctactttgctcagtatcacgaccctgatgatgagcctgttgct
gacccttatgaccagtcctttgaaagcagggacctcctcatagatgagtggaagagcctg
acctatgatgaagtcatcagctttgtgccaccaccccttgaccaagaagaaatggagtcc
tga

DBGET integrated database retrieval system