KEGG   Mus pahari (shrew mouse): 110334720
Entry
110334720         CDS       T05929                                 

Gene name
Stk3
Definition
(RefSeq) serine/threonine-protein kinase 3 isoform X1
  KO
K04412  serine/threonine kinase 3
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04390  Hippo signaling pathway
mpah04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110334720 (Stk3)
   04390 Hippo signaling pathway
    110334720 (Stk3)
   04392 Hippo signaling pathway - multiple species
    110334720 (Stk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110334720 (Stk3)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: STE group
  STE20 family
   110334720 (Stk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Mst1_SARAH ABC1 Pkinase_fungal Prothymosin Abi_2
Other DBs
NCBI-GeneID: 110334720
NCBI-ProteinID: XP_021072238
Ensembl: MGP_PahariEiJ_G0019738
LinkDB
Position
17
AA seq 497 aa
MEQPPASKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPV
ESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTE
DEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNT
VIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPT
FRKPELWSDDFTDFVKKCLVKSPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAK
RHEEQQRELEEEEENSDEDELDSHTMVKTSSESVGTMRATSTMSEGAQTMIEHNSTMLES
DLGTMVINSEEEEEEEEEEEEDGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCDQSM
REPGPMSNSVFPDNWRVPQDGDFDFLKNLSLEELQMRLKALDPMMEREIEELHQRYSAKR
QPILDAMDAKKRRQQNF
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggagcagccgccggcgtccaagagtaagctaaaaaagctgagtgaagacagtttgact
aagcagcctgaagaagtttttgatgtactggagaagcttggagaagggtcttatggaagt
gtttttaaggcaatacataaggaatctggtcaagttgttgcaattaagcaagtacctgtt
gagtcagatcttcaggaaataatcaaagaaatttccataatgcaacaatgtgacagtcca
tacgttgtgaagtactatggcagttactttaagaacacagacctctggattgttatggag
tactgtggagcggggtccgtttcagacataattagattgcgaaacaagacattaacagaa
gatgaaattgcaactattctaaaatccacattgaaaggattagaatatttgcattttatg
aggaaaatacacagagatataaaagccgggaatattctcctcaatacagaaggacatgcc
aagcttgcagattttggagtggctggccagttaacagatacaatggcaaaacgcaatact
gtaataggaaccccattttggatggctcctgaggtaattcaagaaataggttacaactgt
gtggctgacatctggtcccttggcattacttctatagaaatggcagaaggaaaacctcct
tatgctgatatacatccaatgagggctatttttatgatccctacaaacccaccaccaaca
ttcaggaaacctgagctttggtctgatgacttcactgactttgtgaagaagtgcttggtg
aagagtcctgagcagagagccactgcaacacagctgttacagcatccttttatcaagaat
gcaaaacctgtgtcaatattaagagacctgatcacagaagccatggaaatcaaagccaaa
cggcatgaagaacagcaacgagagctagaggaggaggaagaaaactcggatgaagatgag
ctggattcacacactatggtgaagacaagttcagaaagtgtgggcacaatgcgggccacc
agcacgatgagtgaaggagcccagacgatgattgaacataacagcaccatgttagagtcg
gacctggggaccatggttataaacagtgaggaagaggaggaggaggaagaggaagaggaa
gaggacggaactatgaaaagaaatgcaacatcacctcaagtacaaagaccttctttcatg
gactactttgataagcaagacttcaagaacaagagtcatgaaaattgtgatcagagcatg
cgtgagccaggccctatgtccaacagtgtttttcctgacaactggagagttcctcaagat
ggagactttgatttcttaaaaaatctaagtttagaagaactacagatgcggctaaaagca
ctagaccccatgatggaacgagaaatagaagaactgcatcaaagatatagtgcaaaaaga
caacctatcctggatgccatggatgcaaagaagaggaggcagcagaatttctga

DBGET integrated database retrieval system