KEGG   Mus pahari (shrew mouse): 110334729
Entry
110334729         CDS       T05929                                 

Definition
(RefSeq) casein kinase I
  KO
K08960  casein kinase 1, epsilon [EC:2.7.11.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04068  FoxO signaling pathway
mpah04310  Wnt signaling pathway
mpah04340  Hedgehog signaling pathway
mpah04390  Hippo signaling pathway
mpah04392  Hippo signaling pathway - multiple species
mpah04710  Circadian rhythm
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110334729
   04340 Hedgehog signaling pathway
    110334729
   04390 Hippo signaling pathway
    110334729
   04392 Hippo signaling pathway - multiple species
    110334729
   04068 FoxO signaling pathway
    110334729
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    110334729
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110334729
   05022 Pathways of neurodegeneration - multiple diseases
    110334729
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110334729
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mpah03036]
    110334729
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110334729
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   110334729
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    110334729
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal ABC1 APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 110334729
NCBI-ProteinID: XP_021072250
Ensembl: MGP_PahariEiJ_G0020016
LinkDB
Position
17
AA seq 416 aa
MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFYKMMQ
GGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGAARN
PEDVDRERREHEREERMGQLRGSATRALPPGPPTGATANRLRSAAEPVASTPASRIQQAG
NTSPRAISRADRERKVSMRLHRGAPANVSSSDLTGRQEVSRIAASQTSVPFDHLGK
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggagctgcgtgtgggaaataagtatcgcctgggccgaaagatcggcagtgggtccttc
ggagacatctacctgggtgccaacattgcctctggtgaggaagtagccatcaagctcgaa
tgtgtgaagacgaagcatccccagctccacatcgagagcaagttctacaagatgatgcag
ggcggagtggggatcccatccatcaagtggtgcggggctgagggagactataacgtgatg
gtcatggagctgctggggcccagcctggaggacctcttcaacttctgttcccggaagttc
agcctcaagacggtgctgttgctggccgaccagatgatcagccgcatcgagtacatacac
tccaagaacttcatccaccgggatgtgaagcccgacaacttcctcatgggcctggggaag
aaaggcaacctagtgtacatcattgacttcggcctggccaagaagtaccgcgatgcccgc
acacaccagcacattccctaccgggaaaacaagaacctgactggcactgcccgctatgcc
tccatcaacacccacctgggcatcgagcaaagccgtcgagatgacctagagagcttgggc
tatgtgctcatgtacttcaacctgggctccctgccctggcaaggcctcaaagcagccacc
aagcgtcagaagtacgagcggattagcgagaagaagatgtcaacgccaattgaggtcctc
tgcaaaggctacccctccgagttctcaacatacctcaacttctgccgctccctgcggttc
gatgataagcctgactactcctacctgcgccagctcttccgaaatctctttcaccggcag
ggtttctcctacgactacgtcttcgactggaacatgctcaaattcggtgcagcccggaat
cccgaggacgtagaccgggaaagacgggagcacgaacgggaagagaggatggggcagttg
cgagggtctgcgaccagagccctgccccctggcccacctacaggggctaccgccaaccga
ctccgaagtgcagccgagcctgtagcttccaccccagcctcccgcatccaacaagctggc
aatacttctcccagagcgatctcacgggccgaccgagagaggaaggtgagcatgagactc
cacagaggtgcccctgccaacgtctcctcctcagacctcactgggcggcaagaggtctcc
cggattgcagcctcacagacaagcgtgccatttgaccatcttgggaaatga

DBGET integrated database retrieval system