KEGG   Mus pahari (shrew mouse): 110335433
Entry
110335433         CDS       T05929                                 
Name
(RefSeq) H-2 class II histocompatibility antigen, A-S beta chain
  KO
K06752  MHC class II antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04145  Phagosome
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04640  Hematopoietic cell lineage
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04672  Intestinal immune network for IgA production
mpah04940  Type I diabetes mellitus
mpah05140  Leishmaniasis
mpah05145  Toxoplasmosis
mpah05150  Staphylococcus aureus infection
mpah05152  Tuberculosis
mpah05164  Influenza A
mpah05166  Human T-cell leukemia virus 1 infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05310  Asthma
mpah05320  Autoimmune thyroid disease
mpah05321  Inflammatory bowel disease
mpah05322  Systemic lupus erythematosus
mpah05323  Rheumatoid arthritis
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110335433
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110335433
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110335433
   04612 Antigen processing and presentation
    110335433
   04658 Th1 and Th2 cell differentiation
    110335433
   04659 Th17 cell differentiation
    110335433
   04672 Intestinal immune network for IgA production
    110335433
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110335433
   05164 Influenza A
    110335433
   05168 Herpes simplex virus 1 infection
    110335433
   05169 Epstein-Barr virus infection
    110335433
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110335433
   05152 Tuberculosis
    110335433
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110335433
   05140 Leishmaniasis
    110335433
  09163 Immune disease
   05310 Asthma
    110335433
   05322 Systemic lupus erythematosus
    110335433
   05323 Rheumatoid arthritis
    110335433
   05320 Autoimmune thyroid disease
    110335433
   05321 Inflammatory bowel disease
    110335433
   05330 Allograft rejection
    110335433
   05332 Graft-versus-host disease
    110335433
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110335433
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110335433
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110335433
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110335433
  Exosomal proteins of epithelial cells
   110335433
  Exosomal proteins of breast milk
   110335433
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 C2-set_2 ig DUF3592
Other DBs
NCBI-GeneID: 110335433
NCBI-ProteinID: XP_021073239
Ensembl: MGP_PahariEiJ_G0020448
LinkDB
Position
18:2159262..2164710
AA seq 263 aa
MALQIPSLLLSAAVVALMVLSSPGTEGGDSQRHFVYQFKFQCYFTNGTQRIRLVTRYIHN
REEYLRYDSDVGEYRALTELGRPDPDYYNKQYLERTRAELDAVCRHNYEGPETHTSLRRL
EQPNVAISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWT
FQVLVMLEMTPQRGEVYTCHVEHPSLQSPVTVEWRAQSESAQSKMLSGIGGCVLGVIFLG
LGLFIRHRSQKGPRGPPPAGLLQ
NT seq 792 nt   +upstreamnt  +downstreamnt
atggctctgcagatccccagcctcctcctctcagcagcagtggtggcgttgatggtgctg
agcagcccagggactgagggcggagactcccaaaggcatttcgtgtaccagttcaagttc
cagtgctacttcaccaacgggacgcagcgcatacggctcgtgaccagatacatccacaac
cgggaggagtacctgcgctacgacagcgacgtgggcgagtaccgcgcgctgaccgagctg
gggcggccggaccccgactactacaataaacagtacctggagcgaacgcgggccgagctg
gacgcggtgtgcagacacaactacgaggggccggagacccacacctccctgcggcggctg
gaacagcccaatgtcgccatctccctgtccaggacagaggccctcaaccaccacaacaca
ctggtctgctcggtgacagatttctacccagccaagatcaaagtgcgctggttccggaac
ggccaggaggagacggtgggggtctcgtccacacagcttattaggaacggggactggacc
ttccaggtcctggtcatgctggagatgacccctcagcggggagaggtctacacctgccac
gtggagcatcccagcctgcagagcccggtcactgtggagtggcgggcacagtctgagtca
gcccagagcaagatgctgagcggcatcgggggctgcgtgctcggggtgatcttcctcggg
ctcggccttttcatccgtcacaggagtcagaaaggacctcgaggccctcctccagcaggg
ctcctgcagtga

KEGG   Mus pahari (shrew mouse): 110335519
Entry
110335519         CDS       T05929                                 
Name
(RefSeq) H-2 class II histocompatibility antigen, I-E beta chain
  KO
K06752  MHC class II antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04145  Phagosome
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04640  Hematopoietic cell lineage
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04672  Intestinal immune network for IgA production
mpah04940  Type I diabetes mellitus
mpah05140  Leishmaniasis
mpah05145  Toxoplasmosis
mpah05150  Staphylococcus aureus infection
mpah05152  Tuberculosis
mpah05164  Influenza A
mpah05166  Human T-cell leukemia virus 1 infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05310  Asthma
mpah05320  Autoimmune thyroid disease
mpah05321  Inflammatory bowel disease
mpah05322  Systemic lupus erythematosus
mpah05323  Rheumatoid arthritis
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110335519
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110335519
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110335519
   04612 Antigen processing and presentation
    110335519
   04658 Th1 and Th2 cell differentiation
    110335519
   04659 Th17 cell differentiation
    110335519
   04672 Intestinal immune network for IgA production
    110335519
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110335519
   05164 Influenza A
    110335519
   05168 Herpes simplex virus 1 infection
    110335519
   05169 Epstein-Barr virus infection
    110335519
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110335519
   05152 Tuberculosis
    110335519
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110335519
   05140 Leishmaniasis
    110335519
  09163 Immune disease
   05310 Asthma
    110335519
   05322 Systemic lupus erythematosus
    110335519
   05323 Rheumatoid arthritis
    110335519
   05320 Autoimmune thyroid disease
    110335519
   05321 Inflammatory bowel disease
    110335519
   05330 Allograft rejection
    110335519
   05332 Graft-versus-host disease
    110335519
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110335519
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110335519
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110335519
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110335519
  Exosomal proteins of epithelial cells
   110335519
  Exosomal proteins of breast milk
   110335519
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig DUF202
Other DBs
NCBI-GeneID: 110335519
NCBI-ProteinID: XP_021073344
Ensembl: MGP_PahariEiJ_G0020450
LinkDB
Position
18:2204445..2213946
AA seq 264 aa
MMGLPRVPCVAAVILCLTVLSPPVALVRDSRPRFLEYGKAECHFYNGTQRVRLLQRYIYN
REEFLRFDSDVGEFRAVTELGRPDAEYLNSQKDYLEDRRASVDTYCKHNYEVSANFLVPR
SVEPTVTVYPTKTQPLEHHNLLVCSVTDFYPGSIEVRWFRNGVEEKTGIVSTGLIRNGDW
TFQTLVMLETVPQGGEVYTCHVEHPSLSSPVTVEWKAQSTSAQNKMLSGVGGFVLGLLFL
GVGLFIYFRNQKGQSGLQPTGLLS
NT seq 795 nt   +upstreamnt  +downstreamnt
atgatgggtctccccagagttccctgtgtggcagctgtgatcctgtgtctgacagtgctg
agccctccagtggctttggtcagagactccagaccacggtttttggaatatggtaaagct
gagtgtcatttctacaacgggacgcagcgcgtgcggcttctgcagagatacatctacaac
cgcgaggagttccttcgcttcgacagcgacgtgggcgagttccgcgcggtgaccgagctg
gggcggccggacgccgagtacttgaacagccagaaggattacttggaggataggcgggcc
tccgtggacacgtactgcaaacacaactatgaggtctctgctaacttcctcgtgccgcgc
agcgttgagcctacggtgactgtgtaccctacaaagactcagcccctggaacaccacaac
ctcctggtctgctctgtgactgacttctaccctggcagcattgaagtcagatggttccgg
aatggcgtggaggagaagacgggaattgtgtccaccggcctgatccgaaatggagactgg
accttccagacactggtgatgctggagacggttccgcagggcggagaggtttacacctgc
cacgtggagcatcccagcctgagcagccctgtcacagtcgagtggaaagcgcagtccaca
tctgcacagaacaagatgctgagtggagtcgggggcttcgtgctgggcctgctcttcctg
ggagtggggctgttcatctacttcaggaaccagaaaggacagtctggacttcagccaaca
ggactcctgagctga

KEGG   Mus pahari (shrew mouse): 110335565
Entry
110335565         CDS       T05929                                 
Name
(RefSeq) H-2 class II histocompatibility antigen, A-B alpha chain
  KO
K06752  MHC class II antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04145  Phagosome
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04640  Hematopoietic cell lineage
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04672  Intestinal immune network for IgA production
mpah04940  Type I diabetes mellitus
mpah05140  Leishmaniasis
mpah05145  Toxoplasmosis
mpah05150  Staphylococcus aureus infection
mpah05152  Tuberculosis
mpah05164  Influenza A
mpah05166  Human T-cell leukemia virus 1 infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05310  Asthma
mpah05320  Autoimmune thyroid disease
mpah05321  Inflammatory bowel disease
mpah05322  Systemic lupus erythematosus
mpah05323  Rheumatoid arthritis
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110335565
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110335565
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110335565
   04612 Antigen processing and presentation
    110335565
   04658 Th1 and Th2 cell differentiation
    110335565
   04659 Th17 cell differentiation
    110335565
   04672 Intestinal immune network for IgA production
    110335565
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110335565
   05164 Influenza A
    110335565
   05168 Herpes simplex virus 1 infection
    110335565
   05169 Epstein-Barr virus infection
    110335565
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110335565
   05152 Tuberculosis
    110335565
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110335565
   05140 Leishmaniasis
    110335565
  09163 Immune disease
   05310 Asthma
    110335565
   05322 Systemic lupus erythematosus
    110335565
   05323 Rheumatoid arthritis
    110335565
   05320 Autoimmune thyroid disease
    110335565
   05321 Inflammatory bowel disease
    110335565
   05330 Allograft rejection
    110335565
   05332 Graft-versus-host disease
    110335565
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110335565
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110335565
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110335565
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110335565
  Exosomal proteins of epithelial cells
   110335565
  Exosomal proteins of breast milk
   110335565
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 C2-set_2 I-set
Other DBs
NCBI-GeneID: 110335565
NCBI-ProteinID: XP_021073425
Ensembl: MGP_PahariEiJ_G0020449
LinkDB
Position
18:complement(2179941..2186420)
AA seq 256 aa
MPRSRALILGVLALTTMLSVCGGEDDIEADHVGSYGINVYQSPGDNGQYTHEFDGDEQFY
VDLDKKQTVWMLPEFGQLISFDPQGGLQNIATIKYNLEILTKRSNSTPATNEAPQATVFP
KSPVLLGQPNTLICFVDNIFPPVINITWLKNTKPVTEGVYETSFLSNRDHSFHKLSYLTF
IPSDDDIYDCKVEHWGLDEPVLKHWEPEIPAPMSELTETVVCALGLSVGLVGIVVGTIFI
IQGLRSGGTSRHQGPL
NT seq 771 nt   +upstreamnt  +downstreamnt
atgccgcgcagcagagctctgattctgggggtcctcgccctgaccaccatgctcagcgtc
tgtggaggtgaagacgacattgaggccgaccacgtaggctcctatggtataaatgtatat
cagtctcctggagacaatggccagtacacacatgaatttgatggtgatgagcagttctat
gtggacttggataagaagcagactgtctggatgcttcctgagtttggccaattgataagc
tttgacccccaaggtggactgcaaaacatagctacaataaaatacaacttggaaatcttg
actaagaggtcaaattccaccccagctaccaacgaggctcctcaagcgactgtgttcccc
aagtcccctgtgctgctgggtcagcccaacacgctcatctgctttgtggacaatatcttc
cctcctgtgatcaacatcacatggctcaaaaataccaagccagtcacggaaggtgtttat
gagaccagcttcctctccaaccgtgaccattccttccacaagctgtcttacctcaccttc
atcccttctgacgatgacatttatgactgcaaggtggagcactggggcctggatgagcca
gttctgaaacactgggaacctgagattccagcccccatgtcagagctgacagagactgtg
gtctgtgccctggggttgtctgtgggccttgtgggcattgtggtgggcaccatcttcatc
attcaaggcctgcgatcaggtggcacctccagacaccaagggcccttatga

KEGG   Mus pahari (shrew mouse): 110335584
Entry
110335584         CDS       T05929                                 
Name
(RefSeq) H-2 class II histocompatibility antigen, I-E beta chain-like
  KO
K06752  MHC class II antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04145  Phagosome
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04640  Hematopoietic cell lineage
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04672  Intestinal immune network for IgA production
mpah04940  Type I diabetes mellitus
mpah05140  Leishmaniasis
mpah05145  Toxoplasmosis
mpah05150  Staphylococcus aureus infection
mpah05152  Tuberculosis
mpah05164  Influenza A
mpah05166  Human T-cell leukemia virus 1 infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05310  Asthma
mpah05320  Autoimmune thyroid disease
mpah05321  Inflammatory bowel disease
mpah05322  Systemic lupus erythematosus
mpah05323  Rheumatoid arthritis
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110335584
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110335584
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110335584
   04612 Antigen processing and presentation
    110335584
   04658 Th1 and Th2 cell differentiation
    110335584
   04659 Th17 cell differentiation
    110335584
   04672 Intestinal immune network for IgA production
    110335584
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110335584
   05164 Influenza A
    110335584
   05168 Herpes simplex virus 1 infection
    110335584
   05169 Epstein-Barr virus infection
    110335584
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110335584
   05152 Tuberculosis
    110335584
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110335584
   05140 Leishmaniasis
    110335584
  09163 Immune disease
   05310 Asthma
    110335584
   05322 Systemic lupus erythematosus
    110335584
   05323 Rheumatoid arthritis
    110335584
   05320 Autoimmune thyroid disease
    110335584
   05321 Inflammatory bowel disease
    110335584
   05330 Allograft rejection
    110335584
   05332 Graft-versus-host disease
    110335584
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110335584
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110335584
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110335584
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110335584
  Exosomal proteins of epithelial cells
   110335584
  Exosomal proteins of breast milk
   110335584
SSDB
Motif
Pfam: MHC_II_beta C1-set ig Ig_2 C2-set_2
Other DBs
NCBI-GeneID: 110335584
NCBI-ProteinID: XP_021073463
Ensembl: MGP_PahariEiJ_G0020451
LinkDB
Position
18:2230341..2250360
AA seq 290 aa
MVSLWLPRGPCVAAVILSLMALSPPVILVRDPRPRFLEQLKAECHYFNGKERVWSVTRFV
YNQEEFARFNSDSGTFQAVTELGQPIVDYLNTQKDVLNNYRASVDRCRNNYDLVDIFMLN
LKAEPKVTVYPAKTQPLEHHNLLVCSVTDFYPGSIEVRWFRNGMEEKTGIVSTGLIRNGD
WTFQTLVMLETVPEGGEVYTCQVEHPSLSRPVTVEWRARSTSAQNKLVSGAMGLALGLFI
LAVGLSFYLRQLRAESVSHGAGEGAESSTSRLAGSQCGGSECHMGPGLSI
NT seq 873 nt   +upstreamnt  +downstreamnt
atggtgtctctgtggctccccagaggcccctgtgtggcagctgtgatcctgagtcttatg
gcgctgagccctccggtgattttggtcagggacccccgaccacgctttctggagcagttg
aaggctgaatgtcactacttcaatgggaaggagcgtgtgtggagtgtgaccagattcgtc
tataaccaggaagagtttgcccgctttaacagtgactctgggacattccaggcagtgact
gagctggggcagcccatagttgattacttgaacacccagaaggatgtgctgaacaattat
cgtgcctccgtggacaggtgtagaaataactatgaccttgttgatatcttcatgttgaac
ttaaaagctgagcccaaggtgactgtgtaccctgcaaagacgcagcccctggaacaccac
aacctcctggtctgctctgtgactgacttctaccctggcagcattgaagtcagatggttc
cggaatggcatggaggagaagacgggaattgtgtccaccggcctgatccgaaatggagac
tggaccttccagacgctggtgatgctggagacggttccggagggtggagaggtttacacc
tgccaggtggagcatcccagcctgagcaggcctgtcacagtggagtggagggctcggtcc
acatctgcacagaacaagctggtgagtggagccatgggcctggcactcggcctgttcatc
ctcgcagtggggctgtccttctatttaaggcagctgagagcagaatcagtgtctcatggt
gctggtgaaggagctgagagttccacatccagattggcaggcagccaatgtggcgggagt
gaatgccacatgggacctgggttgagcatctga

KEGG   Mus pahari (shrew mouse): 110335630
Entry
110335630         CDS       T05929                                 
Name
(RefSeq) class II histocompatibility antigen, M alpha chain
  KO
K06752  MHC class II antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04145  Phagosome
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04640  Hematopoietic cell lineage
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04672  Intestinal immune network for IgA production
mpah04940  Type I diabetes mellitus
mpah05140  Leishmaniasis
mpah05145  Toxoplasmosis
mpah05150  Staphylococcus aureus infection
mpah05152  Tuberculosis
mpah05164  Influenza A
mpah05166  Human T-cell leukemia virus 1 infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05310  Asthma
mpah05320  Autoimmune thyroid disease
mpah05321  Inflammatory bowel disease
mpah05322  Systemic lupus erythematosus
mpah05323  Rheumatoid arthritis
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110335630
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110335630
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110335630
   04612 Antigen processing and presentation
    110335630
   04658 Th1 and Th2 cell differentiation
    110335630
   04659 Th17 cell differentiation
    110335630
   04672 Intestinal immune network for IgA production
    110335630
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110335630
   05164 Influenza A
    110335630
   05168 Herpes simplex virus 1 infection
    110335630
   05169 Epstein-Barr virus infection
    110335630
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110335630
   05152 Tuberculosis
    110335630
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110335630
   05140 Leishmaniasis
    110335630
  09163 Immune disease
   05310 Asthma
    110335630
   05322 Systemic lupus erythematosus
    110335630
   05323 Rheumatoid arthritis
    110335630
   05320 Autoimmune thyroid disease
    110335630
   05321 Inflammatory bowel disease
    110335630
   05330 Allograft rejection
    110335630
   05332 Graft-versus-host disease
    110335630
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110335630
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110335630
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110335630
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110335630
  Exosomal proteins of epithelial cells
   110335630
  Exosomal proteins of breast milk
   110335630
SSDB
Motif
Pfam: MHC_II_alpha C1-set
Other DBs
NCBI-GeneID: 110335630
NCBI-ProteinID: XP_021073555
Ensembl: MGP_PahariEiJ_G0020441
LinkDB
Position
18:2028498..2046954
AA seq 261 aa
MEHEQKSGAVLLRLLRLLWLLPHSWAVLEASTPVLWDGPQNHTFRHTLFCQDGIPNIGLS
ETYDEDELFSFDFSQNTRVPRLPDFAEWAQGQGDASAIEFDESFCKMLMRDVSPQLEGQI
PVSRGLPVAEVFTLKPLEFGKPNTLVCFVSNLFPPTLTVNWQLHSAPVEGASPTSVSAVD
GLTFQAFSYLNFTPEPFDLYSCTVTHEIDRYTAIAYWVPQNALPSDLLENALCGVAFGLG
VLGIIMGIVFFLCSQRPCSGD
NT seq 786 nt   +upstreamnt  +downstreamnt
atggagcatgagcagaagtcaggagccgtgctgctgaggctgctgcgccttctgtggctg
ctgccccactcctgggcggtgctcgaagcgtcgaccccggtgctgtgggatggcccacag
aaccacacattccggcacactctattctgccaggacgggatccccaacatagggctctcc
gagacctacgacgaggacgaactcttctccttcgacttctcccagaacaccagagtgccc
cgactgcctgactttgctgagtgggctcagggacagggagatgcctctgccattgaattt
gacgaaagcttctgcaagatgttgatgcgggatgtgagcccgcagcttgaaggtcaaatc
ccagtgtccagaggtttgcctgtggcggaagtgttcacactgaagcccctggagtttggc
aagcccaacacgctggtctgtttcgtcagcaacctcttcccaccaaccctgaccgtgaac
tggcaacttcactcggcccctgtggagggagccagccccacgtccgtctcagccgtcgat
gggctgaccttccaggctttctcttatttaaacttcacaccagaaccctttgacctttac
tcctgcaccgtgacacatgagattgaccgctacacggcaattgcctattgggtaccccag
aacgccctgccttcggatctcctagaaaatgcactgtgtggtgtggcctttggccttggt
gtgctaggcatcatcatgggcattgtcttcttcctctgctcccagagaccgtgctcaggt
gactga

KEGG   Mus pahari (shrew mouse): 110335686
Entry
110335686         CDS       T05929                                 
Name
(RefSeq) HLA class II histocompatibility antigen, DO beta chain isoform X1
  KO
K06752  MHC class II antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04145  Phagosome
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04640  Hematopoietic cell lineage
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04672  Intestinal immune network for IgA production
mpah04940  Type I diabetes mellitus
mpah05140  Leishmaniasis
mpah05145  Toxoplasmosis
mpah05150  Staphylococcus aureus infection
mpah05152  Tuberculosis
mpah05164  Influenza A
mpah05166  Human T-cell leukemia virus 1 infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05310  Asthma
mpah05320  Autoimmune thyroid disease
mpah05321  Inflammatory bowel disease
mpah05322  Systemic lupus erythematosus
mpah05323  Rheumatoid arthritis
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110335686
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110335686
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110335686
   04612 Antigen processing and presentation
    110335686
   04658 Th1 and Th2 cell differentiation
    110335686
   04659 Th17 cell differentiation
    110335686
   04672 Intestinal immune network for IgA production
    110335686
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110335686
   05164 Influenza A
    110335686
   05168 Herpes simplex virus 1 infection
    110335686
   05169 Epstein-Barr virus infection
    110335686
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110335686
   05152 Tuberculosis
    110335686
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110335686
   05140 Leishmaniasis
    110335686
  09163 Immune disease
   05310 Asthma
    110335686
   05322 Systemic lupus erythematosus
    110335686
   05323 Rheumatoid arthritis
    110335686
   05320 Autoimmune thyroid disease
    110335686
   05321 Inflammatory bowel disease
    110335686
   05330 Allograft rejection
    110335686
   05332 Graft-versus-host disease
    110335686
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110335686
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110335686
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110335686
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110335686
  Exosomal proteins of epithelial cells
   110335686
  Exosomal proteins of breast milk
   110335686
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 DUF1538 C2-set_2 MHC_I
Other DBs
NCBI-GeneID: 110335686
NCBI-ProteinID: XP_021073648
Ensembl: MGP_PahariEiJ_G0020447
LinkDB
Position
18:2132940..2139621
AA seq 271 aa
MGAGRAPWVVALLVNLMRLDSFMTEGRDSPENFVIQAKADCYFTNGTEKVHFLVRFIFNL
EEYLHFDSDLGMFVALTELGEPDADQWNKRLDLLETSRAAVNMVCRQKYKLGAPFTVERN
VPPEVTVYPERTPLLQQHNLLLCSVTGFYPGDISVRWFRNGQEERSGVVSTGLVRNGDWT
FQTTVMLEMIPELGDIYSCLVEHPGLLRPVSVAWMAQSEYSWTKILSGAAAFLLGLIVFL
VGVVIHLKAQKAPVETQPGHEASRERLHSHS
NT seq 816 nt   +upstreamnt  +downstreamnt
atgggtgctggaagggccccctgggtggtggctctgctggtgaacctcatgaggctggat
tccttcatgactgaaggcagagactccccagagaattttgtgattcaggcaaaggcggac
tgttacttcaccaatggtacagaaaaggttcacttcctggtcaggttcatcttcaacctg
gaggagtatttacacttcgatagtgacctggggatgtttgtggccctgacggagctgggg
gaacctgacgctgaccagtggaacaaacgcctggatctcctggagacgagcagagccgct
gtgaacatggtctgcaggcagaagtacaagctgggggcccccttcaccgtggagagaaat
gtgcctccggaggtgacagtgtaccctgagaggaccccgttgctgcagcagcacaacctg
ctgctctgctctgtgacaggcttctaccccggggacataagtgtcaggtggttccggaat
ggacaggaggagaggtctggagtcgtgtccactggccttgttaggaatggagactggacc
ttccagacaacagtaatgctggaaatgatcccagagcttggcgacatctacagctgcctc
gtggagcaccccggcctcctgagacctgtttctgtggcgtggatggctcagtctgaatat
tcctggacaaagattctgagtggagctgcagcgttcctgcttggactgattgtcttcctg
gtgggagttgttatccatctcaaggctcagaaagcacctgtggagacccagcctggccat
gaggcctcaagagagcgtctccattctcactcctag

KEGG   Mus pahari (shrew mouse): 110335782
Entry
110335782         CDS       T05929                                 
Name
(RefSeq) H-2 class II histocompatibility antigen, E-K alpha chain
  KO
K06752  MHC class II antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04145  Phagosome
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04640  Hematopoietic cell lineage
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04672  Intestinal immune network for IgA production
mpah04940  Type I diabetes mellitus
mpah05140  Leishmaniasis
mpah05145  Toxoplasmosis
mpah05150  Staphylococcus aureus infection
mpah05152  Tuberculosis
mpah05164  Influenza A
mpah05166  Human T-cell leukemia virus 1 infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05310  Asthma
mpah05320  Autoimmune thyroid disease
mpah05321  Inflammatory bowel disease
mpah05322  Systemic lupus erythematosus
mpah05323  Rheumatoid arthritis
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110335782
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110335782
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110335782
   04612 Antigen processing and presentation
    110335782
   04658 Th1 and Th2 cell differentiation
    110335782
   04659 Th17 cell differentiation
    110335782
   04672 Intestinal immune network for IgA production
    110335782
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110335782
   05164 Influenza A
    110335782
   05168 Herpes simplex virus 1 infection
    110335782
   05169 Epstein-Barr virus infection
    110335782
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110335782
   05152 Tuberculosis
    110335782
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110335782
   05140 Leishmaniasis
    110335782
  09163 Immune disease
   05310 Asthma
    110335782
   05322 Systemic lupus erythematosus
    110335782
   05323 Rheumatoid arthritis
    110335782
   05320 Autoimmune thyroid disease
    110335782
   05321 Inflammatory bowel disease
    110335782
   05330 Allograft rejection
    110335782
   05332 Graft-versus-host disease
    110335782
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110335782
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110335782
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110335782
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110335782
  Exosomal proteins of epithelial cells
   110335782
  Exosomal proteins of breast milk
   110335782
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3
Other DBs
NCBI-GeneID: 110335782
NCBI-ProteinID: XP_021073791
LinkDB
Position
18:complement(2252765..2257974)
AA seq 255 aa
MATVGALVLRLFFIAVLMSSQKSWAIKEEHTIIQAEFFLSPDQSGEFMFDFDGDEIFHVD
IGKSETIWRLKEFANFASFEAQGALANIAVDKANLEIMKKRSNNTPDANVAPEVTVLSRS
PVNLGEPNILICFIDKFSPPVVNVTWLRNGHPVTTGVSETVFLPRDDHLFRKFHYLTFLP
STEDYYDCEVDHWGLDEPLRKHWEFEEKTLLPETKENVVCALGLFVGLVGIVVGIILIMK
GIQKRNVVERHQGAL
NT seq 768 nt   +upstreamnt  +downstreamnt
atggccacagttggagccctggtgttaagattgttcttcattgctgttctgatgagctcc
cagaagtcatgggctatcaaagaggaacacaccatcatccaggcagagttctttctttcc
ccagaccaaagcggagagtttatgtttgactttgacggtgatgagattttccatgtagac
attggaaagtcagagaccatctggagacttaaagaatttgcaaactttgccagcttcgag
gctcagggtgcattggctaatatagctgtggacaaagccaacctggagatcatgaaaaag
cgttccaacaacactccagatgcaaacgtggccccagaggtgactgtactctccagaagc
cctgtgaacctgggagagcccaacatcctcatctgtttcattgacaagttctcccctcca
gtggtcaatgtcacctggctccggaatggacatcctgtcaccacaggcgtgtcagagaca
gtgtttcttccgagggacgatcacctcttccgcaaattccactatctgaccttcctgccc
tccacagaagattactatgactgtgaggtggaccactggggcttagacgagcctctgcgg
aagcactgggagtttgaagagaaaaccctcctcccagaaactaaggagaatgttgtgtgt
gcgcttgggttgtttgtgggtctggtgggcatcgtcgttgggattatcctcatcatgaag
ggtattcaaaaacgcaacgttgtagaacgccaccaaggagccctgtga

KEGG   Mus pahari (shrew mouse): 110335853
Entry
110335853         CDS       T05929                                 
Name
(RefSeq) HLA class II histocompatibility antigen, DO alpha chain
  KO
K06752  MHC class II antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04145  Phagosome
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04640  Hematopoietic cell lineage
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04672  Intestinal immune network for IgA production
mpah04940  Type I diabetes mellitus
mpah05140  Leishmaniasis
mpah05145  Toxoplasmosis
mpah05150  Staphylococcus aureus infection
mpah05152  Tuberculosis
mpah05164  Influenza A
mpah05166  Human T-cell leukemia virus 1 infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05310  Asthma
mpah05320  Autoimmune thyroid disease
mpah05321  Inflammatory bowel disease
mpah05322  Systemic lupus erythematosus
mpah05323  Rheumatoid arthritis
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110335853
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110335853
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110335853
   04612 Antigen processing and presentation
    110335853
   04658 Th1 and Th2 cell differentiation
    110335853
   04659 Th17 cell differentiation
    110335853
   04672 Intestinal immune network for IgA production
    110335853
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110335853
   05164 Influenza A
    110335853
   05168 Herpes simplex virus 1 infection
    110335853
   05169 Epstein-Barr virus infection
    110335853
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110335853
   05152 Tuberculosis
    110335853
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110335853
   05140 Leishmaniasis
    110335853
  09163 Immune disease
   05310 Asthma
    110335853
   05322 Systemic lupus erythematosus
    110335853
   05323 Rheumatoid arthritis
    110335853
   05320 Autoimmune thyroid disease
    110335853
   05321 Inflammatory bowel disease
    110335853
   05330 Allograft rejection
    110335853
   05332 Graft-versus-host disease
    110335853
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110335853
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110335853
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110335853
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110335853
  Exosomal proteins of epithelial cells
   110335853
  Exosomal proteins of breast milk
   110335853
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 C2-set_2
Other DBs
NCBI-GeneID: 110335853
NCBI-ProteinID: XP_021073900
Ensembl: MGP_PahariEiJ_G0020439
LinkDB
Position
18:2000781..2004539
AA seq 250 aa
MVLFVELVPVLLTIKSFLSPRGVGAIEADHLGSYGPAFYQSYDASGQFTHEFDGEQIFSV
DLKNEEVVWRLPEFGDFAHSDFQSGLMSISMIGAHLDILVERSNRTRAVSVPPRVTVLPK
SHVELGKPNVLICIVEDIFPPVINVTWLRNSQPITKGVVQTSFYSQPNHKFRKFHYLTFV
PSAEDVYDCKVEHWGLDTPLLQHWEPQLLTPPPDTVETLICGLGLVLGLMGCLLGTVLMI
TGTRMPSIRR
NT seq 753 nt   +upstreamnt  +downstreamnt
atggtcctctttgtggagctggtcccggtactcctaaccataaagagcttcctgagtccc
cgaggagtaggggccatcgaggccgaccacctgggctcctatggccccgccttctaccag
tcttacgacgcctctggacagttcacacacgaatttgacggggaacaaattttctctgtg
gatctgaagaacgaggaggtcgtgtggcgtctgcctgagtttggagacttcgcccactcg
gattttcagagtgggctgatgagcatctccatgatcggcgctcatctggacatcttggtg
gaacgctccaaccgaaccagagccgtcagcgtgcctcccagggtgaccgtactccccaag
tctcatgtggagctcggaaagcccaacgtcctcatctgcattgtggaggatatcttcccg
cctgtgatcaatgtcacctggctgcgcaacagccagcccatcactaagggagtggtccag
accagcttctactctcagcctaaccacaagttccggaagttccactacctgaccttcgtg
ccctctgcggaggatgtgtacgactgcaaggtggagcactggggcctggatacaccgctc
ctccagcactgggagccccagttgcttaccccaccaccggacaccgtagagaccctgatc
tgtggcctgggcctggttctcggccttatgggctgcctcctgggcaccgtgctcatgatc
acaggcacacgcatgcccagtatccgcaggtaa

KEGG   Mus pahari (shrew mouse): 110335947
Entry
110335947         CDS       T05929                                 
Name
(RefSeq) RLA class II histocompatibility antigen, DP alpha-1 chain
  KO
K06752  MHC class II antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04145  Phagosome
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04640  Hematopoietic cell lineage
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04672  Intestinal immune network for IgA production
mpah04940  Type I diabetes mellitus
mpah05140  Leishmaniasis
mpah05145  Toxoplasmosis
mpah05150  Staphylococcus aureus infection
mpah05152  Tuberculosis
mpah05164  Influenza A
mpah05166  Human T-cell leukemia virus 1 infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05310  Asthma
mpah05320  Autoimmune thyroid disease
mpah05321  Inflammatory bowel disease
mpah05322  Systemic lupus erythematosus
mpah05323  Rheumatoid arthritis
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110335947
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110335947
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110335947
   04612 Antigen processing and presentation
    110335947
   04658 Th1 and Th2 cell differentiation
    110335947
   04659 Th17 cell differentiation
    110335947
   04672 Intestinal immune network for IgA production
    110335947
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110335947
   05164 Influenza A
    110335947
   05168 Herpes simplex virus 1 infection
    110335947
   05169 Epstein-Barr virus infection
    110335947
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110335947
   05152 Tuberculosis
    110335947
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110335947
   05140 Leishmaniasis
    110335947
  09163 Immune disease
   05310 Asthma
    110335947
   05322 Systemic lupus erythematosus
    110335947
   05323 Rheumatoid arthritis
    110335947
   05320 Autoimmune thyroid disease
    110335947
   05321 Inflammatory bowel disease
    110335947
   05330 Allograft rejection
    110335947
   05332 Graft-versus-host disease
    110335947
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110335947
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110335947
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110335947
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110335947
  Exosomal proteins of epithelial cells
   110335947
  Exosomal proteins of breast milk
   110335947
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3
Other DBs
NCBI-GeneID: 110335947
NCBI-ProteinID: XP_021074052
LinkDB
Position
18:1986985..1993926
AA seq 258 aa
MFQTKAEVLTTSFLAFLLSLSGSGAIKVRRMAEHIAVYNIFVQTQHASSECMYTFDGDEQ
FYVDLDREEKVWDLPGFSKVYAFDAQEALPYIVSLKNNLRALIQRYNVTQAPSEPPEVTM
FPKNLVELSQPNILICHINRLFPPVLNVTWLHNRQLVTEGTSETVFLPSMELRFHKFHYL
TFIPKAQDVYDYRVEHWGQGQPSLGHWEMQEPVQVSETMETAVCALGLVVGLVGIVVGSV
LILRTPHGSHSPCTQEPL
NT seq 777 nt   +upstreamnt  +downstreamnt
atgttccagactaaagctgaggtcctgacaacctccttcctggccttcctgctgagcctc
tcgggatctggggccatcaaggtcagaaggatggcggaacacatagcagtgtataacata
tttgtacagacacaacatgcatccagtgaatgcatgtacacgtttgatggcgatgagcag
ttctatgtggatcttgacagggaggagaaggtctgggacctgccggggttcagcaaggtg
tatgcatttgacgcccaggaagctttgccctacattgtcagcctgaagaacaatctgcga
gccttgatccagagatacaacgtcacccaggcccccagcgagcctcccgaggtgaccatg
ttccccaagaacctggtagagctgagccagcccaacatcctcatctgccacatcaacagg
ctcttccccccagtgctgaatgtcacatggctgcataacaggcagctggtcactgaggga
acttctgagacggtctttctgcccagcatggaactcagatttcacaagttccattacctt
accttcatacccaaggcgcaggatgtgtatgactacagagtggagcactggggccagggc
cagccgagtcttggtcactgggaaatgcaggagccagtccaagtatctgagacaatggag
actgcggtctgtgccctgggcctggtggtgggcttggtgggcatcgtggttggcagtgtg
ctcatcctaaggactccgcatggcagccatagcccctgcacccaggaacccctatga

DBGET integrated database retrieval system