KEGG   Mus pahari (shrew mouse): 110336078
Entry
110336078         CDS       T05929                                 
Symbol
Ptprm
Name
(RefSeq) receptor-type tyrosine-protein phosphatase mu isoform X1
  KO
K05693  receptor-type tyrosine-protein phosphatase mu [EC:3.1.3.48]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110336078 (Ptprm)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110336078 (Ptprm)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110336078 (Ptprm)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     110336078 (Ptprm)
Protein phosphatases and associated proteins [BR:mpah01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    110336078 (Ptprm)
SSDB
Motif
Pfam: Y_phosphatase MAM fn3 ig DSPc I-set Y_phosphatase3 PTP_tm Ig_3 PTPlike_phytase ECSCR Pur_ac_phosph_N Ig_2 EphA2_TM DctM Nitrate_red_gam DUF948
Other DBs
NCBI-GeneID: 110336078
NCBI-ProteinID: XP_021074150
Ensembl: MGP_PahariEiJ_G0020828
LinkDB
Position
18:complement(33289498..33970378)
AA seq 1486 aa
MRTFGTCLVTLAGLLLTAAGETFSGGCLFDEPYSTCGYSQADEDDFNWEQVNTLTKPTSD
PWMPSGSFMLVNTSGKPEGQRAHLLLPQLKENDTHCIDFHYFVSSKSNAAPGLLNVYVKV
NNGPLGNPIWNISGDPTRTWHRAELAISTFWPNFYQVVFEVVTSGHQGYLAIDEVKVLGH
PCTRTPHFLRIQNVEVNAGQFATFQCSAIGRTVAGDRLWLQGIDVRDAPLKEIKVTSSRR
FIASFNVVNTTKRDAGKYRCMIRTEGGVGISNYAELVVKEPPVPIAPPQLASVGATYLWI
QLNANSINGDGPIVAREVEYCTASGSWNDRQPVDSTSYKIGHLDPDTEYEISVLLTRPGE
GGTGSPGPALRTRTKCADPMRGPRKLEVVEVKSRQITIRWEPFGYNVTRCHSYNLTVHYG
YQVGGQEQVREEVSWDMDNSHPQHTITNLSPYTNVSVKLILMNPEGRKESQELTVQTDED
LPGAVPTESIQGSAFEEKIFLQWREPTQTYGVITLYEITYKAVSSFDPEIDLSNQSGRVS
KLGNETHFLFFGLYPGTTYSFTIRASTAKGFGPPATNQFTTKISAPSMPAYEFETPLNQT
DNTVTVMLKPAQSRGAPVSVYQIVVEEERPRRTKKTTEILKCYPVPIHFQNASILNSQYY
FAAEFPADSLQAAQPFTIGDNKTYNGYWNTPLLPHKSYRIYYQAASRANGETKIDCVRVA
TKAAIIVTQLTTPYIRIAPAAGDGQLTGAVTPKPVPEPEKQTDHTVKIAGVIAGILLFVI
IFLGVVLVMKKRKLAKKRKETMSSTRQEMTVMVNSMDKSYAEQGTNCDEAFSFMGTHNLN
GRSVSSPSSFTMKTNTLSTSVPNSYYPDPFVPTAILDETHTMTSDTSSLAQPHTYKKRET
ADVPYQTGQLHPAIRVADLLQHITQMKCAEGYGFKEEYESFFEGQSAPWDSAKKDENRMK
NRYGNIIAYDHSRVRLQMLEGDNNSDYINGNYIDGYHRPNHYIATQGPMQETIYDFWRMV
WHENTASIIMVTNLVEVGRVKCCKYWPDDTEIYKDIKVTLIDTELLAEYVIRTFAVEKRG
IHEIREIRQFHFTGWPDHGVPYHATGLLGFVRQVKSKSPPNAGPLVVHCSAGAGRTGCFI
VIDIMLDMAEREGVVDIYNCVRELRSRRVNMVQTEEQYVFIHDAILEACLCGDTSIPASQ
VRSLYYDMNKLDPQTNSSQIKEEFRTLNMVTPTLRVEDCSIALLPRNHEKNRCMDILPPD
RCLPFLITIDGESSNYINAALMDSYKQPSAFIVTQHPLPNTVKDFWRLVLDYHCTSVVML
NDVDPAQLCPQYWPENGVHRHGPIQVEFVSADLEEDIISRIFRIYNASRPQDGHRMVQQF
QFLGWPMYRDTPVSKRSFLKLIRQVDKWQEEYNGGEGRTVVHCLNGGGRSGTFCAISIVC
EMLRHQRTVDVFHAVKTLRNNKPNMVDLLDQYKFCYEVALEYLNSG
NT seq 4461 nt   +upstreamnt  +downstreamnt
atgaggacctttgggacttgcctggtgactttagctggacttttgctaactgcggccggc
gaaacattttcaggcggctgcctctttgatgagccatacagcacatgtggatatagtcaa
gctgacgaagatgacttcaactgggagcaggtgaacaccctgaccaagccgacctctgac
ccctggatgccatcaggctccttcatgctggtcaacacgtctgggaaaccagaaggtcag
agagctcacctgctcctgcctcagcttaaggaaaacgacacccactgcatcgactttcac
tactttgtatccagcaagagtaacgctgctcctgggttgctcaatgtctatgtgaaggtg
aataatggaccactggggaatcccatctggaacatatctggagaccccacccgcacgtgg
cacagggcagagctggccatcagcacgttctggcccaacttttaccaggtggtttttgaa
gtggtgacctctggccatcaaggctaccttgctatcgatgaagtcaaggtgttaggacac
ccgtgcacgagaactccccacttcctgcggattcagaacgtggaggtgaatgctggccag
tttgctaccttccagtgcagcgccataggcaggacagtggctggggaccggctctggctg
cagggaattgatgtccgagacgcccctctgaaggagataaaggtgactagttccagaagg
ttcatagcctcatttaacgtcgtaaacacgacgaagagagacgccgggaagtaccgctgc
atgattcgcacagaaggaggtgtcgggatatccaactacgcagaattggtagtgaaagag
ccacctgttcccatcgccccacctcaactcgcctctgtcggagcaacctatctgtggata
cagctcaatgccaactccatcaatggggatggacccattgtggcccgcgaggttgagtac
tgcacagccagtgggagctggaatgatcggcagccggtggattccacaagttacaagatt
gggcaccttgacccagacacagagtatgagatcagtgtgcttctcaccagaccaggagaa
ggcgggactggatctcccgggccagctttgagaacaagaaccaagtgtgctgatcccatg
cgtggcccgagaaaactagaagttgtggaggtcaaatctcgacaaataaccatccgctgg
gagccgtttggatacaatgtcactcgttgccacagttacaatctcacggtgcactacggt
taccaggttggagggcaggagcaggtgcgagaagaagtaagctgggatatggataactcc
caccctcagcacaccatcaccaacctgtccccgtacaccaacgtcagtgtgaagctcatt
ctgatgaacccggagggccgcaaggaaagtcaagaactcacagtgcagacagatgaggac
ctcccaggagctgtccccactgaatccatccaaggcagtgcctttgaagagaagatattt
ctccagtggagagagccgacacaaacatatggggtcatcactttatatgagatcacctac
aaagcagtcagctcctttgacccggaaatagatttatccaaccaaagtggacgagtttca
aaacttggaaatgaaacccattttctgttctttggcctgtaccctggaacgacgtactcc
ttcaccatcagagccagcacagcgaaggggttcggacctccggcaacaaaccagttcacc
acaaaaatatcagcaccgtctatgccagcctatgaatttgagacacctttgaatcagact
gacaataccgtgactgtgatgttgaaacctgcacaaagcagaggggctccagtcagtgtc
tatcaaattgtcgttgaggaggaacgtcctcggagaactaagaagacaacggagatcttg
aagtgttacccggtgccaattcacttccagaatgcttccatcctgaactcacagtactac
tttgctgcagaatttcctgcagacagcctccaagctgctcaaccatttaccatcggtgac
aataagacatacaatggctactggaacacccccctcctcccccataaaagctacagaatt
tattaccaagccgctagtcgagccaatggggaaaccaaaattgactgtgtccgagtggcc
acaaaagctgcgataatcgtgactcagcttacaacaccttacattcgcatcgcccctgct
gcaggcgacggccaactaacaggggccgttactccaaagcctgtccctgaacctgagaaa
caaacagaccatacggttaaaatcgccggagtgattgcaggcatcttgctgtttgttatc
atatttcttggagtcgtgctggtcatgaagaagaggaaactggccaagaagaggaaggag
acgatgagcagcacccggcaggagatgacggtgatggtgaattctatggacaagagctat
gccgagcaaggcaccaactgcgacgaagccttctctttcatgggcacgcacaaccttaat
gggagatccgtgtcctcaccgtcatcctttacaatgaaaacaaacacattgagcacatcg
gtgccaaattcctattacccagacccatttgtgccaactgcaatcttagatgagacccac
acaatgaccagcgacaccagcagcctggcacagccccatacttacaagaaacgcgagacc
gcagacgtgccttaccagacggggcagcttcacccggctatccgtgtggcagacctcctc
caacacatcactcagatgaagtgtgccgagggctatggcttcaaggaggagtatgagagc
ttctttgaaggacagtctgcaccatgggactctgctaagaaagatgagaacagaatgaag
aatagatacgggaacatcattgcatatgatcattctcgggtacggctccagatgctggaa
ggggacaacaattcagactatatcaacggcaattacatcgatggctatcatcgacctaat
cattatattgcaacccaaggacccatgcaggagactatctatgacttctggaggatggtg
tggcacgagaacacggctagcatcatcatggtgaccaaccttgtggaagtgggaagggtg
aaatgctgcaaatactggccagatgacaccgagatctacaaagacattaaagtcacccta
atagatacagagctgctagcagaatatgtgataagaacatttgcagtggaaaagagaggc
attcacgagatccgagagatcagacagtttcacttcaccggctggccggaccacggcgtc
ccctaccatgccactggtctgctgggatttgtccgacaggtcaaatccaagagcccaccc
aatgcaggcccgctggtggtacactgcagtgctggagcaggaaggacgggttgcttcatt
gtcatcgatatcatgctggacatggcagaaagggaaggagtggtggacatctacaactgt
gtcagagagcttcggtccaggagagtcaacatggtgcagacagaggagcagtacgtcttt
atccatgatgcgatcctggaagcctgtctttgtggagacacctccatccctgcctcccaa
gtcaggtcactgtattatgacatgaacaaactggaccctcagacaaactcaagccaaatc
aaagaagaattccggactctcaacatggtgacccccacgctgcgtgtggaggactgcagc
atcgcactcctaccccggaaccatgagaaaaaccgctgcatggacatcctgcctccagac
cgctgcctgcccttcctcatcaccatcgatggagagagcagcaactacatcaatgcagcc
ctaatggatagctataaacagccgtcagcatttatagtcacccagcatcctttgccaaac
accgtcaaagatttctggcgactggtcttggattaccactgcacatccgtagttatgctc
aacgacgtggatcctgcccagctgtgtccacagtactggccagaaaatggagtgcacaga
catggtcccatccaggtggaattcgtgtctgcagacttagaagaagacatcatcagcaga
attttcaggatttacaacgcctccagaccccaggatggacatcggatggtccagcagttc
cagttcctgggctggccgatgtacagggacacgcccgtgtccaagcgctccttcttgaag
ctcatacgccaggtggacaagtggcaggaggaatacaacggcggcgaaggccgcacagtc
gtgcactgcttgaacggaggaggccgcagtggtacattctgtgccatcagcattgtctgt
gagatgctgcgacaccagagaactgtggatgtcttccatgctgtcaagacactgaggaac
aacaagccaaacatggtggacctcctggatcagtacaagttctgctatgaggtggcccta
gagtacctgaattcgggctga

DBGET integrated database retrieval system