KEGG   Mus pahari (shrew mouse): 110336165
Entry
110336165         CDS       T05929                                 

Gene name
Megf8
Definition
(RefSeq) multiple epidermal growth factor-like domains protein 8
  KO
K23664  multipile epidermal growth factor-like domains protein 8
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110336165 (Megf8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mpah04990]
    110336165 (Megf8)
Domain-containing proteins not elsewhere classified [BR:mpah04990]
 Laminin domain-containing proteins
  Laminin EGF-like domain-containing proteins
   110336165 (Megf8)
SSDB
Motif
Pfam: Kelch_4 Kelch_3 Kelch_6 Kelch_5 Kelch_1 CUB Laminin_EGF PSI EGF_CA EGF_3 PSI_integrin EGF_2 EGF
Other DBs
NCBI-GeneID: 110336165
NCBI-ProteinID: XP_021074262
Ensembl: MGP_PahariEiJ_G0021219
LinkDB
Position
19
AA seq 2789 aa
MALGRALAVALALAFAVLGPLSVRVLAGDCKGQRQVLREAPGFVTDGAGNYSVNGNCEWL
IEAPSPQHRILLDFLFLDTECTYDYLFVYDGDSPQGPLLASLSGSTRPPPIEASSGKMLL
HLFSDANYNLLGFNASFRFSLCPGGCQNHGQCKSPGVCVCEPGWGGPDCGLQECSAYCGS
HGTCASTLGPCRCEPGFLGRACDLHLWENQGAGWWHSVSAGDPAFSARIGAAGAFLSPPG
LLAVFGGQDLNKALGDLVLYNFSTNTWESWDLTPAPAARHSHVAVAWAGLLVLMGGELAN
GLLTNDVWAFSPLGGGHWELLAPPASSSSGPPGLAGHAAALVDDIWLYVSGGRTQHDLFS
SGLFRFRLDHASRGYWEQVIPAGGRPPAATGHSMVFHAPSRTLLVHGGHRPSTARFSVRV
NSTELFHVERRVWTTLKGRDGLQGPRERAFHTASVLGNYMVVYGGNVHTHYQEEKCYEDG
IFFYHLGCHQWVSGAELAPPGTPEGRAAPPSGRYSHVAAVLGGSVLLVAGGYSGQPRGDL
MAYKVPPFVFQAPALDYHLDYCSMYTDHSVCSRDPECSWCQGACQAAPPPGTPSGACPAA
SCLGLGRLLSDCQACLAFSSPTAPPRGPGALGWCVHNESCLPRPEQARCRGEQISGTVGW
WGPAPVFVTSLEACVTQSFLPGLHLLTFQQPPNASQPDKVSIVRSTTITLTPSPETDVSL
VYRGFIHPLLPGGPGGPGAEDVAVWARAQRLHVLARMARGPDTENMEEVGRWVAQQEKET
RRLQRPGSDRLFPLPGRGNKYAVEIRGQLNGSAGPGHSELTLLWDRTGVPGGSEISFFFL
EPYRSSACTSYTSCLGCLADQGCGWCLNSATCHLRQVRAHCEDDGSGESLLVLVPALCPL
CEEHRDCHACTQDPFCEWHQSTNRKGDAACSRRGRGRGALKNPEECPPLCSQRLTCEDCL
ANSSQCAWCQSTHTCFLFAAYLARYPHGGCRGWDDSVHSEPRCRSCGGFLTCHECLQSHE
CGWCGNEDNPTLGRCLQGDFSGPLGGGNCSLWVGEGLGLPVALPARWAYARCPDVDECRL
GLARCHPRATCLNTPLSYECHCQRGYQGDGITHCNRTCLEDCGHGVCSGPPDFTCVCDLG
WTSDLPPPTPAPGPPAPRCSRDCGCSFHSHCRRRGPGYCDECQDWTWGEHCERCRPGSFG
NATGSGGCRPCQCNGHGDPRRGHCDNLTGLCFCQDHTEGAHCQICSPGYYGDPRAGGSCF
RECGGRALLTNVSSVALGSRRFGGLLPPGGGAARAGSGLSYCVWVVSATEALQPCVPGTL
CPPLTLTFSPDSSTPCTLSYVLAFDGFPRFLDTGVVQSDRSLIAAFCGQRRDRPLTVQAL
SGLLVLHWEANGSSSWGFNASVGSARCGSGGPGSCPVPQECVPQDGAAGAGLCRCPQGWA
GPHCRMALCPENCNAHTGAGVCNQSLGVCICADGFGGPDCATKLDGGQLVWETLMDSRLS
ADTASRFLHRLGHTMVEGPDATLWMFGGLGLPQGLLGNLYRYSVSERRWTQMLAGAEDGG
PGPSPRSFHAAAYVPAGRGAMYLLGGLTAGGVTRDFWVLNLTTLQWRQEKPPQNMELPAV
AGHTLTARRGLSLLLVGGYSPENGFNQQLLEYQLATGTWVSGAQSGTPPTGLYGHSAVYH
EATDSLYVFGGFRFHVELAAPSPELYSLHCPDRTWSLLAPSQGAKPRPRLFHASALLGDT
MVVLGGRSDPDEFSSDVLLYQVNCNTWLLPALTRPAFVGSPMEESVAHAVAAVGSRLYIS
GGFGGVALGRLLALTLPPDPCRLLPSPEACNQSGACTWCHGACLSGDQAHRLGCGVPPCS
PMPRSPEECRRLRTCSECLARHPRTLQPGDGEASIPRCKWCTNCPEGACIGRNGSCTSEN
DCRINQREVFWAGNCSEAACGAADCEQCTREGKCMWTRQFKRTGETRRILSVQPTYDWTC
FSHSLLNVSPMPVESSPPLPCPTPCHLLPNCTSCLASKGADGGWQHCVWSSSLQQCLSPS
YLPLRCVAGGCGRLLRGPESCSLGCAQATQCALCLRRPHCGWCAWGGQDGGGHCMEGGLS
GPRDGLTCGRPGASWAFLSCPPEDECANGHHDCNETQNCHDQPHGYECSCKTGYTMDNVA
GVCRPVCAQGCVNGSCVEPDHCRCHFGFVGRNCSTECRCNRHSECAGVGARDRCLLCRNH
TKGSHCEQCLPLFVGSALGGGTCRPCHAFCRGNSHVCVSRKELEMARKEPEKYSLDPEEI
EAWVAEGPSEDEAVCVNCQNNSYGDRCESCLHGYFLLDGKCTKCQCNGHADTCNEQDGTG
CPCQNNTETGTCQGSSPSDRRDCYKYQCAKCRESFHGSPLGGQQCYRLISVEQECCLDPT
SQTNCFHEPKRRALGPGRTVLFGVQPKFTNVDIRLTLDVTFGAVDLYVSTSYDTFVVRVA
PDTGVHTVHIQPPPPPPPPPPPADGVPRVAADLGGLGAGSGSGSPVEPRVREVWPRGLIT
YVTVTEPSAVLVVRSVRDRLVITYPHEHHALKSSRFYLLLLGVGDPNGPGANGSADSQGL
LFFRQDQAHIDLFVFFSVFFSCFFLFLSLCVLLWKAKQALDQRQEQRRHLQEMTKMASRP
FAKVTVCFPPDPAGPTPTWKPAGLPPPAFRRSEPFLAPLLLTGAGGPWGPMGGGCCPPAL
PATTAGLRAGPITLEPTEDGMAGVATLLLQLPGGPHAPNGACLGSALVTLRHRLHEYCGG
SGGAGGSGHGGGGGRKGLLSQDNLTSMSL
NT seq 8370 nt   +upstreamnt  +downstreamnt
atggccttgggtagagctctggccgtggctcttgccctggcctttgcagtgctggggccg
ctgtccgtcagggtcctggctggcgactgcaaggggcagcggcaggtgctacgggaggcg
ccaggcttcgtgacggacggtgcgggcaactacagcgtcaatggcaactgcgagtggctt
atcgaggccccgagccctcagcaccggatcctgctggacttccttttcctggacacggag
tgcacttacgactacctctttgtgtatgacggtgactcgccccaaggcccgctgcttgct
agtctgagtgggagcacccggcccccacccattgaagcttcctcaggcaagatgttgctc
cacctcttcagtgatgccaactacaacctgctgggctttaatgcctccttccgcttctcc
ctgtgtcccggaggctgccagaatcatgggcagtgcaagtctccgggagtgtgcgtctgc
gagccgggctggggaggtccagactgtggcctgcaggagtgctcagcctactgtggcagc
cacggcacctgtgcctcgaccctgggaccatgccgctgtgaacctggattcttgggacga
gcctgtgacctgcacttgtgggagaaccagggggctggttggtggcacagtgtgagtgcc
ggggaccctgccttctctgcccgaattggggcagctggtgccttcctgtccccaccaggg
ctgctggctgtctttggaggccaggacctcaacaaggccctcggtgaccttgtcctgtac
aacttctccacaaacacctgggagtcctgggacctgacgcctgctccggctgcccgtcat
tcccacgtggccgtggcctgggctggcttgctggttctgatgggtggtgagctggccaat
ggcttgctaaccaatgacgtgtgggcctttagccccctgggtggaggccactgggagctc
ctggcaccacctgcttccagttcttctgggcccccggggctggcaggccatgcggctgct
ctggtggatgacatctggctctatgtgtctggtggccgcactcagcatgacctcttttct
tctggcctcttccgtttccgcctggaccatgccagcaggggctattgggagcaggtgatc
ccagcaggtgggcggccccctgccgccactgggcactctatggtgttccatgccccgtct
cgtactctgctggtccatggtggacaccggccttccactgcccggttttctgtgcgggtg
aattccactgagctcttccacgtggaacggcgtgtgtggaccacgctgaagggccgggat
gggctccagggtccacgggagagagccttccacactgccagtgttctaggaaactacatg
gtggtctatgggggcaatgtgcatacccattaccaggaggagaagtgttacgaagatggc
atcttcttttaccacctcggctgccaccagtgggtgtcaggggccgagcttgccccgcca
gggacccctgagggtcgagcagcgcctcctagtggccgatactcacatgtggcagctgtt
cttggtggcagtgtcctgctggtggctgggggatatagtggccagcctcgtggggacttg
atggcctacaaggtgccccccttcgtgtttcaggcacctgccctggattaccacctggac
tattgttccatgtacacagaccacagtgtctgctcccgagacccggaatgcagctggtgt
cagggcgcttgccaagctgcgccccctcctgggactccctcaggagcttgtccggcggcc
agctgcctgggcctaggccgcctgctaagtgactgccaagcatgcctggccttcagcagc
cccacagctcctccccggggacctggcgccctaggttggtgtgtgcacaacgagagctgc
cttcctcggcctgagcaggcccgctgccgaggggagcagatctcaggcaccgtgggctgg
tgggggccagcacccgtcttcgtcacttccctggaggcttgtgtcacccagagcttcctc
cctggcctgcacctgctcaccttccagcagccacccaacgcctctcagcctgacaaggtc
tccattgtccgaagtacaactatcaccttgacacccagcccagagacagatgtgtcccta
gtctaccgaggcttcatccaccccctgctgccaggaggaccaggcggccctggggctgaa
gatgtggctgtgtgggctcgggcccagcgcctccatgtcttggcccggatggccagaggc
cctgacactgagaacatggaggaggtgggacgctgggtggctcagcaggagaaggagaca
cggcgtctgcagcgccctggctctgatcgcctcttcccactgcccgggcgaggcaacaag
tatgcggtggagatccgaggccagctcaatggctccgcgggccctgggcatagtgagctc
accctcctgtgggatcggactggcgtgccgggcggcagtgagatctccttcttcttcctg
gagccctaccgctcttcggcctgcacctcttacacctcctgtctgggctgcctggccgat
cagggctgtggctggtgcctcaacagcgccacctgtcacctgcgtcaggtcagggcccac
tgtgaggatgacgggagcggcgagtccctgctggtgctggtgcctgccctctgtccactc
tgtgaggagcatcgtgactgtcatgcctgcacccaggaccccttctgtgagtggcatcag
agcaccaaccgcaaaggagacgcggcatgcagccggcgaggccggggccgaggcgctctg
aagaacccagaggaatgccccccactctgcagccaacggctgacctgtgaggactgcctg
gccaactccagccagtgtgcctggtgccagtccactcacacctgctttctgtttgctgcc
tacctggcccggtacccacacgggggctgccgtggctgggacgacagtgtgcactcagag
ccacggtgcaggagctgcggtggctttttgacttgtcacgagtgtctacagagccacgag
tgtggttggtgtggcaatgaagataaccccactctgggacggtgcctacagggggacttc
tctggacccctgggtggggggaactgctccctctgggtgggagagggcctggggctgcct
gtggctctccctgcccgctgggcttatgcccgctgtccagatgtggatgaatgtcgcctg
ggcctggcgaggtgtcacccacgggcaacctgcctgaacacgcctctcagctatgagtgt
cattgccaacgcggctaccagggtgatggcatcacacactgtaaccgcacgtgcctggaa
gactgtggccacggtgtatgtagcggtcctccggactttacttgtgtgtgtgacctgggc
tggacctcagacctgcccccacccacgcctgccccaggaccccctgccccgcgttgttct
cgggactgtggctgcagctttcatagccactgccgcaggcggggacctggctactgtgac
gagtgccaggactggacgtggggggaacactgtgaacgatgccggcctggcagctttggc
aatgcaaccggctctggtggctgccgaccctgccagtgtaatgggcatggggacccacgt
cgtggccactgtgacaacctcactgggctctgcttctgccaggaccacactgagggtgcc
cactgtcagatttgctctccaggatactatggggacccccgagccggtggctcctgcttc
cgggagtgtgggggtcgtgcactcctcaccaatgtgtcttcggtggctctgggctcccgc
cgcttcgggggacttctgcctccaggtggtggggcagcaagagctgggtccgggctgtcc
tactgcgtgtgggttgtctcggccacagaagcgctgcagccctgtgtccctggcaccctc
tgccccccgctcaccctcaccttctctccagacagcagcacaccttgcacactgagctac
gtcctggcctttgacggattcccacgcttcctggacaccggtgttgtccagtcagaccgg
agcctcatagctgccttctgtggccagcggcgcgacagacctctcactgtgcaggcttta
tccgggttacttgtgctgcactgggaagccaatggctcctcctcctggggattcaatgct
tctgtgggctctgcccgatgtggatcgggaggtcctggcagttgtcctgtccctcaggaa
tgtgtgccccaggatggggctgcaggtgctgggctctgccgatgccctcagggttgggct
ggccctcactgccgcatggctctgtgtcctgagaactgcaacgcccacaccggggcaggg
gtttgtaaccagagcctaggtgtgtgcatctgtgccgacggttttggtggcccagactgt
gccacgaagctggatggtggacagttggtctgggaaacgctcatggacagccgcctctca
gctgacactgctagtcgcttccttcaccgcctgggacatactatggtagagggacctgat
gccactttgtggatgtttgggggcctgggtctgccacagggcctgctgggaaacctgtac
aggtattcagtcagtgagcgcagatggacacagatgttggcaggagctgaggatgggggc
ccaggcccatcaccccgttccttccatgcagctgcctatgtgcctgctggccgaggtgcc
atgtacctgctggggggcctcacagctgggggcgtcacccgtgacttctgggtccttaac
ctcactaccctgcagtggagacaggagaagccccctcagaacatggagctgccagcagtc
gctggtcacactcttactgcccgtcgaggcctatctctgctcttggtgggtggctactcc
cccgaaaatggcttcaaccagcagttgttggagtaccagctggcaactggcacctgggta
tctggagcccagagtgggacgcccccgacaggtctctatggtcactctgcagtctaccat
gaggccaccgactccctctacgtgttcgggggtttccgcttccatgtggagctggcagcg
ccttctccggagctctactccctgcactgtcctgaccgtacctggagcctgctggcacct
tctcagggagcaaagccccggccccggcttttccacgcttcagctctgctcggagatacc
atggtggtccttggggggcgctcagaccctgatgaattcagcagtgacgttcttctctac
caggtcaactgcaacacctggctcctgcctgccctcacccgtccagcctttgtggggtcc
ccgatggaggagtctgtggcccatgcagtggcagcagtgggtagccgcctgtacatctct
ggaggatttgggggagtagccttgggccgcctgctggcattgaccttgccccccgacccc
tgccgtctgctgccttcgcctgaagcttgtaatcagtctggggcctgcacctggtgccac
ggtgcttgcctgtctggggaccaggcccacaggctgggttgtggggtacccccttgctcc
ccaatgcctcgctcacctgaggagtgtcggagactgcggacctgcagtgagtgcctggcc
cgccatcctcggaccctgcagcccggagatggagaggcatccattccccgttgtaagtgg
tgcaccaactgcccagagggtgcctgtattgggcgcaatgggtcctgcacctcagagaat
gactgtcgaatcaaccagcgagaggtcttctgggctggcaattgctcggaggctgcatgt
ggggctgctgactgtgagcagtgcacgcgggagggcaagtgcatgtggacacggcagttc
aagaggaccggggagactcgccgaatcctgtcggtgcagcccacctacgactggacttgc
ttcagccattctctgctgaatgtgtctcctatgcccgtggagtcctcgcccccactgccc
tgccccacgccctgtcacctcctgcccaactgcacatcctgcctggcctccaagggtgca
gacgggggctggcagcactgtgtgtggagcagtagcctccagcagtgtctgagcccctct
tatctgcccttgcgatgtgtggctggaggctgtgggcggctgcttagggggccagagagc
tgctcgctgggctgcgctcaggcgacgcagtgtgccctgtgcctgcgacgaccccactgt
ggctggtgtgcctgggggggccaggatgggggtggccactgcatggaaggaggtctcagt
ggtccccgagacgggctaacctgtggacgtcccggggcatcctgggccttcctgtcttgc
ccccctgaggacgagtgtgccaacgggcaccatgactgcaatgagacccagaactgccac
gaccagccccacggctacgagtgcagctgcaagacaggctacaccatggacaatgtggct
ggcgtctgccgccccgtgtgtgcccagggctgtgtgaacggctcctgtgtggaacctgac
cactgccgctgtcactttggctttgtcggccgcaactgctccacagagtgtcgctgcaac
cggcacagtgagtgtgctggcgtcggggcgcgggaccgctgcctgctgtgccggaaccac
accaagggtagccactgtgagcagtgtctcccactgttcgtgggttcagctttgggtgga
gggacctgccgaccctgccatgccttctgtcgagggaacagccatgtgtgcgtctctcgg
aaagagctagagatggccagaaaggagccagagaaatactcactggatccagaggagatt
gaagcctgggtggcagaaggtcccagtgaggatgaagctgtgtgtgtgaactgccagaac
aacagctatggggacagatgtgagagctgcctccacggctactttctcctggacgggaaa
tgtaccaaatgccagtgtaatggccacgctgacacctgtaacgagcaggacggaacagga
tgcccatgtcagaacaacacagagacaggcacctgccagggcagctctcccagtgaccgc
cgagactgctacaagtaccagtgtgctaagtgccgcgagtcgttccacgggagcccgcta
ggtggccagcagtgttaccgactcatctctgtggaacaagagtgctgcctggaccccact
tcccagaccaactgcttccatgagcccaagcgccgggccctgggtcctggccgcaccgtg
ctgtttggcgtccaacccaagttcaccaatgtggacattcgcctgacactagacgtgacc
ttcggcgctgtggacctctatgtctccacctcctatgacacttttgtggtccgagtggcc
cctgacacaggcgtccacactgtgcacatccagccacctccacctcccccacctcctccg
cctcctgctgatggtgtaccccgggtggctgcggacctaggaggattgggggctggaagt
gggtcaggttctccggtggagccacgggtccgggaggtgtggccacggggcctgattacc
tacgtgacagtgacagaaccctcagcagtgctggtggtccgcagtgtgcgggacaggctg
gtgatcacctatccccatgagcaccacgccctcaaatcgagccgcttctacctgctgctg
ctgggtgtgggcgaccccaatgggcctggtgccaacggctcggcagactcacagggcctg
ctcttcttccggcaagaccaggcccacattgacttgttcgtcttcttctccgtgttcttt
tcctgcttcttcctcttcctctcgctctgtgtgcttctctggaaggccaagcaggctctg
gaccagcgacaagagcagcgccggcacctgcaggagatgaccaagatggccagccgcccc
tttgccaaggtcactgtctgcttccctccagatcctgcaggcccaacacctacgtggaag
ccagccgggctcccccctcctgccttccgccgctctgagcctttcctagcacccctgttg
ctgacaggagccggggggccctggggacccatgggaggtgggtgctgcccaccagccctc
cctgccaccacagctggcctacgagctgggcccatcacccttgagcccacagaagatggc
atggctggtgtggccactctgctgctccagctacctggggggcctcatgctcccaatggg
gcctgccttgggtcagccctcgtcactctgcgtcacaggctgcatgagtactgtgggggg
agtgggggtgctggaggcagtggacacgggggtggtggaggccggaagggactgttgagt
caggacaatctcactagcatgtccctttga

DBGET integrated database retrieval system