KEGG   Mus pahari (shrew mouse): 110336703
Entry
110336703         CDS       T05929                                 
Symbol
F10
Name
(RefSeq) coagulation factor X isoform X1
  KO
K01314  coagulation factor X [EC:3.4.21.6]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110336703 (F10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110336703 (F10)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110336703 (F10)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.6  coagulation factor Xa
     110336703 (F10)
Peptidases and inhibitors [BR:mpah01002]
 Serine peptidases
  Family S1: chymotrypsin family
   110336703 (F10)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   110336703 (F10)
SSDB
Motif
Pfam: Trypsin Gla FXa_inhibition EGF hEGF Trypsin_2 cEGF DUF1986 EGF_3 EGF_CA EGF_2
Other DBs
NCBI-GeneID: 110336703
NCBI-ProteinID: XP_021075075
Ensembl: MGP_PahariEiJ_G0021293
LinkDB
Position
19:31489881..31509526
AA seq 493 aa
MPVTATAVLDHIMGSPARLGLLCVVLANLLLSGRGVFINRERANNVLARTRRANSFFEEF
KKGNLERECMEEICSYEEVREIFEDDEKTKEYWNKYKDGDQCESNPCQNQGACRDGIGGY
TCTCSEGFEGKNCELFVRKLCRLDNGDCDQFCNEEQNSVVCSCASGYFLGNDGKSCISTA
PFPCGKFTTGRRKRSVALNTSNSELDLEDLLLDEDILSPTENPSELLNLNQTQPERSSDD
LVRIVGGRECKDGECPWQALLINEDNEGFCGGTILNEFYILTAAHCLHQARRFKVRVGDR
NTEKEEGNEMVHEVDVVIKHNKFQRDTYDFDIAVLKLKTPITFRMNVAPACLPQKDWAES
TLMTQKTGIVSGFGRTHEKGRQSNILKMLEVPYVDRNTCKLSTSFSITQNMFCAGYEAKL
EDACQGDSGGPHVTQFKNTYYVTGIVSWGEGCARKGKYGIYTKVTTFLKWIDRSMKARVG
PTAETPRSAGPPN
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgcctgtcacagccactgctgtccttgaccacatcatggggagcccggcgcgactcggc
ctgctctgtgttgtcctggccaacctcctgctctctgggagaggtgtgtttattaaccgg
gaacgtgccaacaatgtcctggcgaggactcggagggcaaactcattttttgaagagttc
aagaaaggaaatctggaaagagaatgcatggaagaaatttgttcttacgaagaggtccgt
gaaatcttcgaggatgatgagaagacgaaagaatactggaacaaatataaagatggcgac
cagtgtgaaagcaacccttgtcagaaccaaggcgcgtgtcgagacggcatcgggggttac
acgtgtacctgctcagagggcttcgaaggcaaaaactgtgagctctttgttcggaaactc
tgccgcctagacaatggagactgtgaccagttctgcaatgaagagcagaactcagtggtg
tgctcctgtgccagcggttacttcctgggtaatgatggcaagtcctgcatctccacagct
cccttcccctgtggaaaattcactaccggacgcaggaagaggtctgtggccctaaacacc
agcaacagtgaacttgaccttgaagacctcctgcttgatgaggatatcctgtcccctacg
gagaatccttctgaactgctcaacctcaaccagacacagcctgagaggagcagcgacgac
cttgttcgaattgtgggtggccgggaatgcaaggacggagaatgtccctggcaggctctg
ctcattaacgaagacaatgaagggttctgtgggggcaccatcttgaatgagttctacatt
ctcaccgctgcccactgtctccatcaggccagacgattcaaggtgagggtaggggatcgg
aacacagagaaggaagaaggcaacgagatggtacacgaggtggacgtggtcattaagcac
aacaagtttcagagggacacctacgactttgatatcgccgtgctgaagctgaagacccct
atcacgttccgcatgaacgtggcccctgcctgcctgcctcagaaagactgggccgagtct
acactgatgacacagaagacgggcatcgtgagcgggtttggacgcacgcacgagaagggc
cgccagtcgaacatcctgaagatgctggaggtgccctacgtggatcgcaacacctgcaag
ctctccaccagctttagcatcacacagaatatgttctgtgcgggctatgaggccaagtta
gaggacgcctgccagggggacagtggtggcccccatgtcacacagttcaaaaacacctac
tatgtgaccggcattgtcagctggggagaggggtgtgcgaggaaagggaaatatggcatc
tacacaaaggtcacgaccttcctcaagtggattgacaggtccatgaaagccagggtggga
cccacagccgagaccccaaggtcagcaggtccgcccaattaa

DBGET integrated database retrieval system