KEGG   Mus pahari (shrew mouse): 110337055
Entry
110337055         CDS       T05929                                 
Symbol
F11
Name
(RefSeq) coagulation factor XI isoform X1
  KO
K01323  coagulation factor XI [EC:3.4.21.27]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110337055 (F11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110337055 (F11)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.27  coagulation factor XIa
     110337055 (F11)
Peptidases and inhibitors [BR:mpah01002]
 Serine peptidases
  Family S1: chymotrypsin family
   110337055 (F11)
SSDB
Motif
Pfam: Trypsin PAN_1 PAN_4 DUF1986 Trypsin_2 PAN_2
Other DBs
NCBI-GeneID: 110337055
NCBI-ProteinID: XP_021075455
Ensembl: MGP_PahariEiJ_G0021484
LinkDB
Position
19:complement(61454277..61478851)
AA seq 628 aa
MTSLHQVLHFIFFATVSTECVTKVFKDISFQGGDLSTVFTPSATYCRLICTHHPRCLLFT
FMAESSSDDPTKWFACILKDSVTETLPMVNMTGAVSGYSFKQCPQQLSACSKDVFVNLDM
KGMNYNSSVVKNARECQERCTDDAHCQFFTYATGHFPSVGHRKMCLLKYTRTGTPTTITK
LNNVVSGFSLKSCGLSNLACIRDIFPNTVLADLNIDSVVAPDAFVCRRICTHHPTCLFFT
FFSQAWPKESQRHLCLLKTSESGLPSTRITTSHALSGFSLQHCRHSVPVFCHPSFYNDTD
FLGEELDIVDVKGQETCQKTCTNNARCQFFTYYPSRGSCNERNFVFNGRDRCYLKLSSNG
SPTRILHGKGGISGYSLRLCKMDNVCTTKIKPRVVGGAASVHGEWPWQVTLHTSRGHLCG
GSIIGNQWILTAAHCFSEIETPKNLRVYGGIINQSEINEDTAFFKVQEMIIHDQYTTAES
GYDIALLKLESAMNYTDFQRPICLPSKGDKNAGHTECWVTGWGYTELRGEVQSTLQKAKV
PLVSNEECQIRYRRHKITNKMICAGYKEGGKDTCKGDSGGPLSCKYNGVWHLVGITSWGE
GCGQKERPGIYTNVAKYVDWILEKTQTV
NT seq 1887 nt   +upstreamnt  +downstreamnt
atgacctcgctacatcaggtgttacattttatcttttttgccacagtgtctactgaatgt
gtcactaaggtcttcaaagacatcagctttcaaggaggtgacctgagtactgttttcaca
ccgagcgccacgtactgccgcctgatctgcactcaccacccacggtgcctgctcttcaca
ttcatggctgagtcatcttccgatgatcctaccaaatggtttgcctgcatcctgaaggac
agcgtcacagaaacattgccaatggtaaacatgacaggcgcggtctctggatattccttc
aagcaatgccctcagcaattaagtgcttgcagcaaagatgtgttcgtgaacctagacatg
aagggcatgaactataacagctctgttgtgaagaatgctcgagaatgccaggagagatgc
acagacgatgcccactgtcagtttttcacatatgcaacagggcattttcccagtgtgggc
catcgtaaaatgtgtcttttgaagtacacccggacggggacaccaaccacaataacgaag
ctcaataacgtggtatctggattttcactgaagtcctgtggactttcaaacttggcttgt
atcagggacattttcccgaacacggtgctggcagaccttaacattgacagcgtggtggcc
ccagatgctttcgtctgtcgtcgcatctgcacgcatcaccccacttgtttgttcttcaca
ttcttttcccaagcatggccaaaagagtctcagagacatctttgtctccttaaaacatct
gaaagtgggttaccaagcacacgcattacaacgagccacgccctttccgggttcagtctc
cagcactgcaggcacagcgtcccagtgttctgccatccgtccttttacaatgacactgat
ttcttgggagaagagctggacatcgtcgatgtgaaaggccaagaaacctgccagaaaacg
tgcaccaataatgcccgctgccagttctttacctattatccatcacgaggatcttgcaat
gaaaggaattttgttttcaatggtagggacagatgttacttaaagctctcctcaaatgga
tctccgactagaatccttcatgggaagggaggcatctctggatactcactgaggctgtgc
aaaatggataatgtgtgcacaaccaaaatcaagcccagggtggtgggaggagctgcgtct
gttcacggtgagtggccgtggcaggtgaccctgcacaccagccggggacacctgtgtgga
ggctccatcatcggaaaccagtggatactgacagcggctcattgtttctctgagatagag
acacctaaaaatctgcgtgtctacggtggcattataaatcaatcagaaataaatgaagat
actgctttcttcaaggttcaagaaatgataattcatgatcagtatacgacggcagaaagt
gggtatgatattgccctgttaaaactggaatcagccatgaattacacagattttcagcgg
ccaatatgcctgccttccaaaggagacaaaaatgccgggcacacagaatgttgggtgact
ggatgggggtacacagaactaagaggtgaagtacaaagtactctccagaaagccaaggta
ccattggtgtcaaatgaagaatgtcagataagatacagaagacataaaataaccaacaag
atgatctgtgctggctacaaagaaggagggaaggatacatgcaagggagattctggaggg
cccctgtcttgcaaatacaatggggtctggcatttggtgggcatcacaagctggggtgaa
ggttgtggtcagaaggagagaccagggatctacaccaacgtggccaagtacgtggactgg
attttggagaaaactcaaacagtctga

DBGET integrated database retrieval system