KEGG   Mus pahari (shrew mouse): 110337184
Entry
110337184         CDS       T05929                                 
Symbol
Gypa
Name
(RefSeq) glycophorin-A
  KO
K06575  glycophorin A
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04640  Hematopoietic cell lineage
mpah05144  Malaria
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110337184 (Gypa)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    110337184 (Gypa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110337184 (Gypa)
CD molecules [BR:mpah04090]
 Proteins
  110337184 (Gypa)
SSDB
Motif
Pfam: Glycophorin_A Syndecan DUF6040 Pertussis_S1
Other DBs
NCBI-GeneID: 110337184
NCBI-ProteinID: XP_021075607
Ensembl: MGP_PahariEiJ_G0022860
LinkDB
Position
20:5124806..5140254
AA seq 167 aa
MTESTTAVTTSGHFLTTTFHIPSSQHYQEEHSRSLPGSDPLLHVTTPVVALTVGNPNQHS
AAMSTSDINFTSHPMAPTEVTAMPEHPVSPHGGGMMVPIRHNFPALVMILIILGVMAGII
GTILLISYFISRMTKKSSVDIQSPEGGDNGVPLSSIEQTPNQEFSNV
NT seq 504 nt   +upstreamnt  +downstreamnt
atgaccgagagcacaaccgctgtgacaacatcgggtcattttcttacaaccaccttccat
ataccttcaagtcaacattaccaagaagagcattcacggtcattgccaggatcagatcct
cttcttcatgtaaccactcctgtggtggctctaactgtaggcaacccaaatcagcattca
gcagcaatgtcaacatcagatattaatttcacatctcaccccatggcccctactgaagtg
actgctatgcctgaacaccctgtctcaccacatggtggaggaatgatggtaccaattcga
cataattttcctgcactagtgatgatactcataattttgggcgtgatggctgggattatt
ggcactatccttcttatctcttactttatcagccgaatgacaaagaaaagttcagttgac
atccaatctcctgagggtggtgacaacggcgtgcctttgagttctattgaacagacccct
aatcaagagttctccaatgtttga

DBGET integrated database retrieval system