KEGG   Mus pahari (shrew mouse): 110337562
Entry
110337562         CDS       T05929                                 
Symbol
Cdh15
Name
(RefSeq) cadherin-15
  KO
K06809  cadherin 15, M-cadherin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110337562 (Cdh15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mpah04515]
    110337562 (Cdh15)
Cell adhesion molecules [BR:mpah04515]
 Cadherins
  Major cadherins
   110337562 (Cdh15)
SSDB
Motif
Pfam: Cadherin CADH_Y-type_LIR RET_CLD1
Other DBs
NCBI-GeneID: 110337562
NCBI-ProteinID: XP_021076205
Ensembl: MGP_PahariEiJ_G0023271
LinkDB
Position
20:46035845..46054187
AA seq 784 aa
MGSALLFALGLLAQSLGLSWAVPEPEPSTLYPWRRASAPVRVRRAWVIPPISVSENHKRL
PYPLVQIKSDKQQLGSVIYSIQGPGVDEEPRNVFSIDKFTGRVYLNATLDREKTDRFRLR
AFALDLGGSTLEDPTDLEIVVVDQNDNRPAFLQDVFRGRILEGAIPGTFVTRAEATDADD
PETDNAALRFSILEQGSPEFFSIDEHTGEIRTVQVGLDREVVAVYNLTLQVADMSGDGLT
ATASAIISVDDINDNAPEFTKDEFFMEAAEAVSGVDVGRLEVEDKDLPGSPNWVARFTIL
EGDPDGQFKIYTDPKTNEGVLSVVKPLDYESHEQYELRVSVQNEAPLQAAAPRARRGQTR
VSVWVQDTNEAPVFPENPLRTSIAEGAPPGTSVTTFSARDPDTEQLQRISYSKDYDPEDW
LQVDGATGRIQTQRVLSPTSPFLKDGWYRAIILALDNAIPPSTATGTLSIEILEVNDHAP
ALAPPPFGSLCSEPDQGPGLLLGATDEDLPPHGAPFHFQLNPRVPDLSRNWSLSQINVSH
ARLRLRHQVSEGLHRLSLLLQDSGEPPQQREQTLNVTVCRCGSDGTCLPGAAALRGGGVG
VSLGALVIVLASTVVLLILILLAALRTRFRGQSRSKNLLHGLQEDLRDNILNYDEQGGGE
EDQDAYDINQLRHPVEPRVTSRSLGRPPLRRDAPFSYVPQPHRVLPTSPSDIANFISDGL
EAADSDLSVPPYDTALIYDYEGDGSVAGTLSSILSSLGDEDQDYDYLGDWGPRFARLADM
YGHQ
NT seq 2355 nt   +upstreamnt  +downstreamnt
atgggttctgctctgctcttcgccctcgggctgcttgcccagagccttggcctgtcctgg
gcagtccctgagcccgaacccagcaccctgtacccctggcgccgggcatcagccccggtc
cgtgtgcggagagcctgggtcatcccacccatcagtgtgtctgagaaccacaaacgcctc
ccctacccacttgtgcagatcaagtctgacaaacagcagttaggcagtgtcatctacagc
atccagggtcccggagtggatgaggagccccgaaatgtcttctccatcgacaagttcacc
gggagggtgtacctcaacgccacgctggaccgtgagaagacggaccgcttcaggctaagg
gcctttgccctcgacttgggtggctctaccctggaggaccccacggacctggagatcgtt
gtggtggatcaaaatgacaaccggccagccttcctacaggatgtgttcagaggccgcatc
ctggagggcgccatcccaggcaccttcgtcaccagggctgaggccacagatgccgacgac
ccagagacagacaacgcagccctcaggttctccatcctggagcagggtagccctgagttc
ttcagcattgatgagcacactggagagatccgcacagtgcaagtggggctggaccgtgag
gtggtggctgtgtataacctgaccttgcaggtggcagacatgtcgggagatggcctcact
gccacagcctcggccatcatctccgtagatgacatcaacgacaatgccccggagttcacc
aaggatgagttctttatggaggctgcagaggctgtcagtggagtggatgtgggacggctc
gaggtggaagacaaggacctgcctggttcccccaactgggtggccaggttcaccatcctg
gaaggcgatcctgacgggcagttcaagatctacacagaccccaagaccaatgaaggtgtg
ctgtctgtggtcaagcccctggactatgagagccatgagcagtatgagctcagagtgtct
gtacagaatgaggctccgctgcaggcagctgcccctcgggcccggcggggccagaccagg
gtcagtgtgtgggttcaggacaccaatgaagctccagtgtttccagagaacccactgagg
acgagcatagctgaaggggcccccccaggcacctctgtgaccaccttctctgccagagac
cctgacacagaacagctgcagaggatcagctactccaaagactacgacccagaagactgg
ctgcaagtggacggggccacgggcaggatccagacccagcgagtgctgagccccacttcg
ccctttttgaaggatggctggtacagggccatcatcctagccctggacaatgctattcct
cctagcacagccacaggcaccctgtccattgagatcctagaagtcaacgaccatgcccct
gcactggctcctcctccatttggcagcctatgcagtgaaccagaccagggccctggcctc
ctcttgggtgccacggatgaagacctgcccccgcatggggctcccttccacttccagctg
aacccaagagtaccagatctcagccggaactggagcctcagccagattaacgtgagtcat
gcacgcctgcggctccgacatcaggtctctgagggcctgcatcgcctgagcctgctactc
caggactctggggagccaccccaacagcgagagcaaacactgaacgttaccgtgtgtcgc
tgtgggtcggacggcacttgcctgccaggggctgccgcgctgcgaggaggaggtgtaggc
gtcagcttgggggcactggtcattgtgctggccagcaccgtggtcctattgattctcatc
ctgcttgccgcgctccgcacacggttccgggggcagtctcggagcaagaatctgttgcat
gggctacaagaggaccttcgagacaacatccttaactacgatgagcaaggaggcggggaa
gaggaccaggatgcttacgacataaaccagctgcgccacccagtggagccaagggtcacc
agccgctctttgggcaggccacccctgcgcagggatgcccccttcagctatgtgccacag
ccgcatcgagtgcttcccaccagcccatctgacattgccaacttcatcagtgatggcttg
gaggctgcggacagtgacctcagcgtgcctccctacgacacagctctcatctatgactac
gagggagatggctctgtggcagggacactgagctccattctgtccagcctgggggatgaa
gaccaggactatgactacctcggggactggggcccccgctttgctcggctggcggacatg
tatggccatcagtga

DBGET integrated database retrieval system