KEGG   Mus pahari (shrew mouse): 110337800
Entry
110337800         CDS       T05929                                 
Symbol
Mc1r
Name
(RefSeq) melanocyte-stimulating hormone receptor
  KO
K04199  melanocortin 1 receptor
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04080  Neuroactive ligand-receptor interaction
mpah04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110337800 (Mc1r)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110337800 (Mc1r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mpah04030]
    110337800 (Mc1r)
G protein-coupled receptors [BR:mpah04030]
 Rhodopsin family
  Peptide
   Melanocortin
    110337800 (Mc1r)
SSDB
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srsx 7TM_GPCR_Srx Pox_A14 FtsL_2
Other DBs
NCBI-GeneID: 110337800
NCBI-ProteinID: XP_021076502
Ensembl: MGP_PahariEiJ_G0023287
LinkDB
Position
20:46585677..46586958
AA seq 315 aa
MPVQGPQKRLLGSLNSTATPHLGLATNQTGPGCLLVSIPDGLFLSLGLVSLVENVLVVVV
ITKNRNLHSPMYYFICCLALSDLMVSVSIVLETTIILLLEAGILVSRAALVQQLDNVIDV
LICGSMVSSLCFLGVIAIDRYISIFYALRYHSIVTLPRARRAVVGIWMVSIISSTLFITY
YKHTAVLICLVTFFLAMLALMAILYAHMFTRACQHAQGIAQLHKRQQSLRQGFCLKGVAT
LTVLLGIFLLCWGPFFLHLSLIVLCPQHPTCSCIFKNFNLFLILIILSSIVDPLIYAFRS
QELRMTLKEVLLCSW
NT seq 948 nt   +upstreamnt  +downstreamnt
atgcccgttcaggggccccagaagaggcttctgggttctctcaactccaccgccacccct
caccttggactggccaccaaccagacagggcctgggtgcctgcttgtgtccatcccagat
ggcctcttcctcagcctggggctggtgagtctggtggagaatgtgttggtcgtggtagtt
atcaccaagaaccgcaacctgcactcgcccatgtattacttcatctgctgcctggccctg
tctgacctgatggtgagtgtcagcatcgtgctggagaccactatcatcctgctgctggag
gcgggcatcctggtgtcccgcgcggctttggtgcagcagctggacaatgtcattgacgtg
ctcatctgtggctccatggtgtccagtctctgcttcctgggtgtcattgctatagaccgc
tacatctccatcttctatgctctgcgttatcacagcatcgtgacgctgccccgggcacgc
cgggctgtcgtgggcatctggatggtcagcatcatctccagcaccctctttatcacctac
tacaagcacacagccgttctgatctgcctcgtcactttctttctagccatgctggcactc
atggcgattctgtacgcccacatgttcacgcgagcgtgccagcatgctcagggcattgcc
cagctccacaaaagacagcagtccctccgccaaggcttctgcctcaagggtgtcgccact
cttactgtccttctggggattttcctcctgtgctggggccccttcttcctgcatctctcg
ctcatcgtcctctgccctcagcaccccacctgcagctgcatcttcaagaacttcaacctc
ttcctcatcctcatcatcctcagctccattgtggaccccctcatctacgctttccgcagc
caggagctccgcatgacactcaaggaggtgctgctgtgctcctggtaa

DBGET integrated database retrieval system