KEGG   Mus pahari (shrew mouse): 110338342
Entry
110338342         CDS       T05929                                 
Name
(RefSeq) formyl peptide receptor-related sequence 1
  KO
K04173  formyl peptide receptor-like
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04080  Neuroactive ligand-receptor interaction
mpah04613  Neutrophil extracellular trap formation
mpah05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110338342
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110338342
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110338342
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mpah04030]
    110338342
G protein-coupled receptors [BR:mpah04030]
 Rhodopsin family
  Peptide
   fMet-Leu-Phe
    110338342
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 110338342
NCBI-ProteinID: XP_021077328
Ensembl: MGP_PahariEiJ_G0023422
LinkDB
Position
21:13299654..13300862
AA seq 351 aa
METNYSIPLNGTDVVVYDSTISRVLLIFSMVVVSITFFLGVLGNGLVIWVAGFQMAHTVT
TICYLNLALADFSFTVTLPFLLISMAMKEKWPFGWFLCKLVHIAVDVNLFGSVFLIAVIA
LDRCICVLHPVWAQNHRTVSLARKVVVGPWIFALILTLPLFLFLTTVRDPRGDVHCIFSF
VSWGNSVEERLNTAITFVTTRGIIRFIIGFSMPMSIVAICYGLITTKIHKKAIVNSSCPL
RVLTAVVVSFFICWFPFQLVALLGTVWLKEMLFSGSYKILGRLVNPTSSLAFFNSCLNPI
LYVFMGQDFQERLIHSLSSRLQRALSEDSCHISDTRANLASLPEDIEIKAI
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggaaaccaattactctatccctctgaatggaacagatgtggtggtatatgattctacc
atctccagggttctgttgatcttctcaatggtggttgtctccatcacttttttcctcggt
gtgttgggcaatgggctagtgatctgggtagctggattccagatggcacacactgtcaca
actatctgttatcttaatctagcattggctgacttctctttcacagtgactctaccattt
cttctcatctcaatggctatgaaagaaaaatggccttttggctggttcctgtgtaaatta
gttcacattgcggtagatgtaaacctgtttggaagtgtcttcttgattgctgtcattgcc
ttggaccgctgtatttgtgtcctgcatccagtctgggctcagaaccaccgcactgtgagc
ctggctaggaaggtggttgttgggccctggatttttgctctgattctcactttgcccctt
ttcctcttcttgactacagttagagatcctagaggggatgtgcactgtatatttagtttt
gtatcctggggcaactctgttgaggaaaggttgaacacagctatcacttttgtaacaact
agagggatcatcaggttcattattggcttcagcatgcccatgtccattgttgccatctgc
tatggactcatcactaccaagatccacaaaaaagccattgttaattccagctgtccttta
cgagttcttacagcagttgtggtttccttctttatctgttggtttccttttcaattggtt
gcccttttaggcacagtctggctcaaagagatgctgtttagtggtagttataaaattctt
ggcaggttggttaatccaaccagctcattggcctttttcaatagctgcctcaatccaatt
ctctatgttttcatgggccaggactttcaagaaagactgattcattccctgtcttctcgt
ctgcagagagccctgagtgaggactcttgtcatatcagtgatacaagagccaatttggct
tcacttcctgaagacattgagataaaggcaatatga

KEGG   Mus pahari (shrew mouse): 110338349
Entry
110338349         CDS       T05929                                 
Name
(RefSeq) formyl peptide receptor-related sequence 4
  KO
K04173  formyl peptide receptor-like
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04080  Neuroactive ligand-receptor interaction
mpah04613  Neutrophil extracellular trap formation
mpah05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110338349
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110338349
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110338349
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mpah04030]
    110338349
G protein-coupled receptors [BR:mpah04030]
 Rhodopsin family
  Peptide
   fMet-Leu-Phe
    110338349
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 110338349
NCBI-ProteinID: XP_021077337
Ensembl: MGP_PahariEiJ_G0023423
LinkDB
Position
21:13346234..13347205
AA seq 323 aa
MEVNISMPLNGSEVVFYDSTTSRVLWILSLVLLSITFVLGVLGNGLVIWVAGFQMAHTVT
TVSYLNLALSDFSFMATLPLHIITMVMEGKWLFGWFLCKLVHIIANINLFVSIFLITLIA
MDRCVCVLHPVWAQNHRTVSLARKVVVGAWIFALLLTLPHFLFLTTVRDARGDVHCISKF
ESWVSTSEEQLKVSVIAATASGIINFIIGFSMPMSFIAICYGLMAAKICRRGFVNSSRPL
RVLTAVAVSFFVCWFPFQLIMLLGNIFNNETLSIIHMLVNPANTLASFNSCLNPILYVFL
GQEFRDRLIYSLSASLERALRED
NT seq 972 nt   +upstreamnt  +downstreamnt
atggaagtcaacatatcaatgcctctgaatggatcagaagttgtgttttatgattctacc
acctcaagagttctatggatcctctcattagttcttctctctataacctttgtccttggt
gtactaggtaatgggcttgtgatttgggtggctgggttccagatggcacacactgtgacc
actgtctcttatctgaacttggctttgagtgatttctctttcatggctactctaccactt
cacatcatcacaatggtcatggaaggaaaatggctttttggttggtttctttgcaaattg
gttcacattattgcaaacataaacctttttgtaagtatcttcctaatcactctcattgct
atggatcgctgtgtttgtgtcctgcacccagtatgggctcagaatcaccgaactgtgagt
ctggccagaaaagtggttgttggagcttggatatttgctctgctgcttaccttgccacat
tttctcttcttgactacagtgagagatgcaagaggggatgtacactgtatatctaaattt
gaatcctgggtttcaacctctgaggagcagttaaaggtgtctgttattgctgccacagct
tcaggaatcatcaatttcattattggattcagcatgcccatgtctttcattgctatctgc
tatggactcatggctgccaagatctgtagaagaggctttgtgaattccagccgtccttta
cgtgtcctcactgctgtagcagtttctttctttgtctgctggttcccttttcaattaatt
atgcttttaggcaacatctttaataatgagacactgagcattattcatatgttggttaac
ccagcaaacaccttggcttccttcaacagctgcctcaacccaatactctatgtattcctg
ggtcaggaattcagagacagactaatctattctctgtctgccagtctagagagggccctg
agggaagactag

KEGG   Mus pahari (shrew mouse): 110338357
Entry
110338357         CDS       T05929                                 
Symbol
Fpr2
Name
(RefSeq) N-formyl peptide receptor 2
  KO
K04173  formyl peptide receptor-like
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04080  Neuroactive ligand-receptor interaction
mpah04613  Neutrophil extracellular trap formation
mpah05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110338357 (Fpr2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110338357 (Fpr2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110338357 (Fpr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mpah04030]
    110338357 (Fpr2)
G protein-coupled receptors [BR:mpah04030]
 Rhodopsin family
  Peptide
   fMet-Leu-Phe
    110338357 (Fpr2)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 110338357
NCBI-ProteinID: XP_021077353
Ensembl: MGP_PahariEiJ_G0023421
LinkDB
Position
21:13244511..13249964
AA seq 351 aa
METNYSIHLNGSDVVVYDSTISRVLWILSMVVVSITFFLGVLGNGLVIWVAGFRMPHNVT
TIWYLNLALADFSFTATLPFLLVEMAMKEKWPFGWFLCKLVHIVVDINLFGSVFLIAVIA
LDRCICVLHPVWAQNHRTVSLARKVVVGPWIFALILTLPIFIFLTTVRIPGGDVYCTFNF
RSWAQTDEEKVNIAITFVTTRGIIRFLIGFSMPMSIVAICYGLIAVKIHRRTLVNSSRPL
RVLTAVVASFFICWFPFQLVALLGTVWFKEKLFSGSYTILDMFVDPTSSLAYFNSCLNPM
LYVFMGQDFRERFIHSLPSSLERALSEDSGQTSDTGTSSTSPPADIEMKVP
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggaaaccaactactccatccatctgaatggatcagatgtggtggtctatgattctacc
atctccagagtcctgtggatcctttcgatggtggttgtctccatcactttcttccttggt
gtgttgggcaatggactagtgatctgggtagctggattccggatgccacacaatgtcaca
actatctggtatctgaatctagctttggctgacttctctttcacagcaactctaccattc
ctccttgtcgaaatggctatgaaagaaaaatggccttttggctggttcctgtgtaaatta
gttcacattgtggtagatataaacctgtttggaagtgtcttcttgattgctgtcattgcc
ttggaccgctgtatttgtgtcctgcatccagtctgggctcagaaccaccgcactgtgagc
ctggctaggaaggtggttgttgggccctggatttttgctctgattctcactttgccgatt
tttattttcttgactactgttagaattcctggaggagatgtgtattgtacattcaacttt
agatcctgggctcaaactgatgaagaaaaggtgaacatagctatcacgttcgtaacaact
agagggatcatcaggttccttattggcttcagcatgcccatgtccattgttgccatctgc
tatggactcatcgctgtcaagatccacagaagaacccttgttaattccagccgtccttta
cgagttcttacagcagttgtggcttccttctttatctgttggtttccctttcagctggtg
gcccttttgggcacagtctggtttaaagagaaattgtttagtggtagttatacaattctt
gacatgtttgttgatccaacaagctcattggcttacttcaatagttgtctcaatccgatg
ctctatgttttcatgggccaggacttccgtgagagatttattcattccctgccttctagt
cttgagagggccctgagtgaggactctggtcaaaccagtgatacaggaaccagttctact
tcacctcctgcagacattgagatgaaggtaccatga

KEGG   Mus pahari (shrew mouse): 110338374
Entry
110338374         CDS       T05929                                 
Name
(RefSeq) formyl peptide receptor-related sequence 6
  KO
K04173  formyl peptide receptor-like
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04080  Neuroactive ligand-receptor interaction
mpah04613  Neutrophil extracellular trap formation
mpah05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110338374
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110338374
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110338374
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mpah04030]
    110338374
G protein-coupled receptors [BR:mpah04030]
 Rhodopsin family
  Peptide
   fMet-Leu-Phe
    110338374
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 110338374
NCBI-ProteinID: XP_021077371
Ensembl: MGP_PahariEiJ_G0023425
LinkDB
Position
21:complement(15589237..15590256)
AA seq 339 aa
MEANFSIPQNGSEVVFCDSTTSRVICIFLVVVLSITFLLGVLGNGLVIYMAGFQMAHTVT
TICYLNLALSDFSYMASLPFQIISIVMNGEWLFGWFLCKFVHMIVNINLFLSIFLITFIA
MDRCICVLHPVWAQNHRTVNLARKVIIGAWILVVLFIFPHCIFVTTVKDESGKVHCICNF
ESWAATPEEQVKVSMTMSLISVTINCIIGFSIPMIFIVICYGLMAAKIGRRGFMNSSRPL
RVLTAVAISFFVCWFPFQLIFLLGNIGNKETQTNIDPWVNPATTLASFNSCLNPILYVFL
GQQFRERLIYSLSASLERALREDSALNSDKIRNFSSQRH
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggaagccaacttctccatacctcagaatggatcagaagtggtgttttgtgattctacc
acctccagagttatatgtatcttcttagttgtggtcctctctataacctttctccttggt
gtgctaggtaatgggcttgtgatttatatggctgggttccagatggcacacactgtgaca
acaatctgttatctgaacctggcattgtctgacttctcttacatggcaagtctaccattt
cagatcatctcaattgtcatgaatggagaatggctatttggttggttcctttgcaaattt
gttcacatgattgtaaacataaatctttttctaagtatcttcctgattactttcattgcc
atggatcgctgtatttgtgttctgcatccagtatgggctcagaatcatcgaactgtgaat
ctggcaaggaaagtgatcattggagcttggatacttgttgtactgtttatatttccacat
tgtatcttcgtgactacagtgaaagatgaaagtgggaaagtgcactgtatatgtaatttt
gaatcctgggctgcaacccctgaggagcaagtaaaagtgtccatgactatgagtttaatt
tctgtaaccatcaattgcattattggcttcagcatacctatgatcttcattgtcatctgt
tatggactcatggctgccaagataggcagacgaggctttatgaattccagtcgtccttta
cgtgttctcactgctgtagcaatttctttttttgtttgttggttccctttccagctgatt
tttcttttaggcaatattgggaacaaggagacacagactaatattgacccatgggtgaac
ccagcaaccactctggcctccttcaacagttgcctcaacccaatactctatgttttccta
ggtcagcaatttagagagagacttatttactccctatcagctagtctggagagggcccta
agggaggattcagccctgaacagtgacaaaatcagaaacttttcttcacaaagacactga

KEGG   Mus pahari (shrew mouse): 110338482
Entry
110338482         CDS       T05929                                 
Name
(RefSeq) formyl peptide receptor-related sequence 3
  KO
K04173  formyl peptide receptor-like
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04080  Neuroactive ligand-receptor interaction
mpah04613  Neutrophil extracellular trap formation
mpah05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110338482
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110338482
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110338482
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mpah04030]
    110338482
G protein-coupled receptors [BR:mpah04030]
 Rhodopsin family
  Peptide
   fMet-Leu-Phe
    110338482
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 110338482
NCBI-ProteinID: XP_021077478
Ensembl: MGP_PahariEiJ_G0023434
LinkDB
Position
21:complement(15928673..15929716)
AA seq 347 aa
MEANSSIPLNGSEVVFYDPTTSRVLWILSVIVLSITFVLGVLGNGLVIWVAGFRMAHTVT
TICYLNLALGDFSFMVTLPIHIISMVMKGKWLFGWFLCKFVLSIVHINLFVSVFLITLIA
MDRCICVLHPVWSQNHRTVSLARKVVVGAWILSLLLTLPHFLFLTTVRDARGEVHCTCNF
ESVAANPEEQLKVSITVSTATGIISFIIGFSLPMSFIAICYGLMAAKICRKGFLNSSRPL
RVLTAVAISFFMCWFPFQLIILLGNIWNNETPSSIHILLNPASTLASFNSCLNPILYVFL
GQEFREKLIDSLSASLERALREDSVLSSGKSRNLSSCPADSELYRKW
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggaagccaactcctccatcccactgaatggatcagaagtggtgttttatgatcctacc
acctccagagttctgtggatcctctcagtgatagtcctctccataacctttgtccttggt
gtgctaggtaacgggcttgtgatttgggtggctgggttccggatggcacacactgtgacc
accatctgttatctgaacctggctttgggtgacttctctttcatggttacgttaccaata
cacatcatctcaatggtcatgaaaggaaaatggctttttggttggttcctttgcaaattt
gttctcagcattgtacacataaacctttttgtaagtgttttcctgatcactctcattgcc
atggatcgttgtatttgtgtcctgcacccagtatggtctcagaatcaccgaactgtgagt
ctggccaggaaagtggttgttggagcgtggattctttctctgctacttaccttgccacat
tttctcttcttgactacagtgagagatgcaagaggggaagtgcactgtacatgtaacttt
gaatctgtggctgcaaaccctgaggagcaattaaaggtgtcaattactgtgagcacagca
acaggaatcatcagttttattattggcttcagcctacccatgtccttcattgccatctgc
tatggactcatggctgccaagatttgcagaaaaggctttctgaactccagccgtccctta
cgtgttctcactgctgtagcaatttccttctttatgtgttggttcccttttcaactgatt
attcttttaggcaatatctggaataatgagacaccaagcagcattcacattttgttgaac
ccagcaagcacactggcttccttcaacagctgtctcaacccaatactctatgtctttctt
ggtcaagaatttagagagaaactgatagattccctgtctgccagtctggagagggcactg
cgagaagactcagtcctaagcagtggcaaaagcaggaacttatcttcatgtcctgcagac
tctgaactatataggaagtggtag

DBGET integrated database retrieval system