Mycolicibacterium parafortuitum: MPNTM1_05510 Help Entry MPNTM1_05510      CDS       T11082                                  Name (GenBank) hypothetical protein   KO K27095   acyl-CoA carboxylase epsilon subunit Organism mpat  Mycolicibacterium parafortuitum Pathway mpat00074   Mycolic acid biosynthesis mpat00280   Valine, leucine and isoleucine degradation mpat00630   Glyoxylate and dicarboxylate metabolism mpat00640   Propanoate metabolism mpat01100   Metabolic pathways mpat01110   Biosynthesis of secondary metabolites mpat01120   Microbial metabolism in diverse environments mpat01200   Carbon metabolism Module mpat_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA mpat_M00887   Mycolic acid biosynthesis, meromycolic acid + alpha-carboxyacyl-CoA + trehalose => TMM => TDM/mAGP/GMM Brite KEGG Orthology (KO) [BR:mpat00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     MPNTM1_05510    00640 Propanoate metabolism     MPNTM1_05510   09103 Lipid metabolism    00074 Mycolic acid biosynthesis     MPNTM1_05510   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     MPNTM1_05510 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACC_epsilon Motif Other DBs NCBI-ProteinID:  XCI64327 LinkDB All DBs Position 5828269..5828550 Genome browser AA seq 93 aa AA seqDB search MNHDADIVEVSDPRDMTIDDPPAPTPHFQVLKGEPTLEELAALVTVLAGAGGGAPADPGP QELNLWGHPVDKLRYDVTSWQRTTLWERTHMRH NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaccatgacgccgacatcgtcgaggtctccgatccgcgggacatgaccatcgacgac ccgcccgcacccaccccgcacttccaggtcctcaagggcgaacccaccctcgaagaactc gccgcgctcgtcaccgtgctggccggcgccggcggcggcgcacccgccgaccccggaccc caggaactcaacctctggggccacccggtcgacaaactgcgctacgacgtcaccagctgg cagcgcaccaccctgtgggaacgcacccacatgcggcactga

DBGET integrated database retrieval system