KEGG   Moniliophthora perniciosa: MPER_12173
Entry
MPER_12173        CDS       T01089                                 
Name
(GenBank) hypothetical protein
  KO
K21820  unspecific peroxygenase [EC:1.11.2.1]
Organism
mpr  Moniliophthora perniciosa
Brite
KEGG Orthology (KO) [BR:mpr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MPER_12173
Enzymes [BR:mpr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.2  Peroxygenases
    1.11.2.1  unspecific peroxygenase
     MPER_12173
SSDB
Motif
Pfam: Peroxidase_2 DUF6777
Other DBs
NCBI-ProteinID: EEB89701
UniProt: E2LY01
LinkDB
AA seq 227 aa
FSPMKLTLNIVRVTLAITVATARLANPLPVTRSPHDEIDWSKHQYQAPQEGDARGPYPGL
NTYATFHSQLLPCSRINNSLANHGFLARNGMNITIPAVLQGSFGTENFLTSHGHSLIRCV
DGFNLPTKELLFAAKASVFTSDLLDQFSLNDIKLHGNIEHDASLSRVDHALGDNTIFNSL
IYATLASSNPGADYYNGTSACQVPKERLAHLLANNPQRDEHNQGVFD
NT seq 684 nt   +upstreamnt  +downstreamnt
tttagccccatgaagctcacactaaacatcgtccgagtcacgcttgctattactgtagcc
accgcaaggctggctaaccctcttcctgtcactcgcagcccccatgacgagattgactgg
tcaaagcaccagtatcaagcccctcaagaaggtgacgctcgcggtccgtatcctggtctc
aacacgtacgctactttccactctcaactacttccatgctcacgcatcaacaatagcctt
gcaaaccacggcttccttgcccgtaatggtatgaacattaccattcccgccgtgctacaa
ggatctttcggtacggaaaatttcttgacatctcatggccattcactcatacgctgcgta
gacggattcaacctccccactaaggagcttctctttgctgccaaggcatcggtgtttaca
tccgaccttttggatcaattctctttgaacgacatcaagctgcatggcaatatcgaacac
gatgcctctctatcccgcgtcgatcacgctcttggcgacaacaccatcttcaactcgttg
atctacgccacactagcctcatccaaccctggcgcggattattacaacggtacctcagca
tgccaagtcccaaaggagagattggcgcatctcttggcaaataatccacaacgtgacgaa
cacaatcaaggagtttttgattag

DBGET integrated database retrieval system