KEGG   Mustela putorius furo (domestic ferret): 101670642
Entry
101670642         CDS       T07239                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
mpuf  Mustela putorius furo (domestic ferret)
Pathway
mpuf04927  Cortisol synthesis and secretion
mpuf04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:mpuf00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    101670642 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101670642 (MRAP)
SSDB
Motif
Pfam: MRAP ABC2_membrane_4 DUF420
Other DBs
NCBI-GeneID: 101670642
NCBI-ProteinID: XP_004757558
Ensembl: ENSMPUG00000001120
UniProt: M3XPW1
LinkDB
Position
Unknown
AA seq 140 aa
MTLRKSVGQSLRGLGPASDAPLASAADMANETNASSAYDGYGYEYYLDYLDLIPVDERKL
KANKYFIVITFWVSLASFVMLLFLILLYMSWSGSSQGRNNTQHHTTCPWSHSLHLPLCIR
GQPPGSTELGRSPRRPSTQP
NT seq 423 nt   +upstreamnt  +downstreamnt
atgactttacggaaatcagttggccagtccctccgagggcttggacccgcttcggatgcg
ccgcttgccagtgccgcagacatggccaacgagaccaacgcctccagcgcgtacgacggc
tacggctacgagtactacctggattacctggacctcattcccgttgatgagaggaagctg
aaagccaacaaatatttcatcgtcatcaccttctgggtgagcctggcgtccttcgtcatg
cttctcttcctcatcctgctctacatgtcctggtcgggctcctcacaggggaggaacaac
acccagcaccacacaacatgcccctggagtcacagcctccacctcccgctctgcatccgg
gggcagccccccggctccacggagctcggccggagccccaggcggccgagcacgcagccc
tga

DBGET integrated database retrieval system